Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Platelet-Derived Growth Factor Subunit A (PDGFA) Active Protein | PDGFA active protein

Recombinant Human Platelet-Derived Growth Factor Subunit A (PDGFA)

Gene Names
PDGFA; PDGF1; PDGF-A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Platelet-Derived Growth Factor Subunit A (PDGFA); Recombinant Human Platelet-Derived Growth Factor Subunit A (PDGFA); Platelet-derived growth factor subunit A; PDGF subunit A; PDGF-1; Platelet-derived growth factor A chain; Platelet-derived growth factor alpha polypeptide; PDGFA; PDGF1; PDGFA active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 4 mM HCl
Sequence Positions
87-211aa; Full Length of Mature Protein
Sequence
SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
Sequence Length
211
Species
Human
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 300 ng/ml.
Subcellular Location
Secreted
Protein Families
PDGF/VEGF Growth Factor Family
Classification
Cytokine
Subdivision
Growth Factor
Pathway
Jak-STAT Signaling Pathway
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for PDGFA active protein
Relevance: Platelet-derived growth factor subunit A (PDGFA), belongs to the PDGF/VEGF growth factor family. PDGFA is a secreted protein, stored in platelet alpha-granules and released by platelets upon wounding. PDGFA is potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. It plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. PDGFA is required for normal lung alveolar septum formation during embryogenesis, normal development of the gastrointestinal tract, normal development of Leydig cells and spermatogenesis, normal oligodendrocyte development and normal myelination in the spinal cord and cerebellum. It plays an important role in wound healing; Signaling is modulated by the formation of heterodimers with PDGFB.

Function: Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal lung alveolar septum formation during embryogenesis, normal development of the gastrointestinal tract, normal development of Leydig cells and spermatogenesis. Required for normal oligodendrocyte development and normal myelination in the spinal cord and cerebellum. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFB (By similarity).
Product Categories/Family for PDGFA active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14.1 kDa
NCBI Official Full Name
platelet-derived growth factor subunit A isoform 1 preproprotein
NCBI Official Synonym Full Names
platelet derived growth factor subunit A
NCBI Official Symbol
PDGFA
NCBI Official Synonym Symbols
PDGF1; PDGF-A
NCBI Protein Information
platelet-derived growth factor subunit A
UniProt Protein Name
Platelet-derived growth factor subunit A
UniProt Gene Name
PDGFA
UniProt Synonym Gene Names
PDGF1; PDGF subunit A
UniProt Entry Name
PDGFA_HUMAN

NCBI Description

This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit A, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit B. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]

Uniprot Description

PDGFA: Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal lung alveolar septum formation during embryogenesis, normal development of the gastrointestinal tract, normal development of Leydig cells and spermatogenesis. Required for normal oligodendrocyte development and normal myelination in the spinal cord and cerebellum. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFB. Belongs to the PDGF/VEGF growth factor family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Cytokine; Cell cycle regulation; Secreted

Chromosomal Location of Human Ortholog: 7p22

Cellular Component: Golgi membrane; extracellular space; microvillus; cell surface; endoplasmic reticulum lumen; extracellular region

Molecular Function: collagen binding; protein binding; protein homodimerization activity; growth factor activity; protein heterodimerization activity; platelet-derived growth factor binding; platelet-derived growth factor receptor binding

Biological Process: skin development; extracellular matrix organization and biogenesis; nerve growth factor receptor signaling pathway; wound healing; negative chemotaxis; platelet-derived growth factor receptor signaling pathway; cell projection biogenesis; response to estradiol stimulus; positive regulation of MAP kinase activity; positive regulation of fibroblast proliferation; regulation of smooth muscle cell migration; platelet degranulation; hair follicle development; positive regulation of MAPKKK cascade; cell-cell signaling; transforming growth factor beta receptor signaling pathway; positive regulation of cell proliferation; positive regulation of mesenchymal cell proliferation; response to wounding; angiogenesis; inner ear development; regulation of peptidyl-tyrosine phosphorylation; epidermal growth factor receptor signaling pathway; response to drug; platelet activation; response to inorganic substance; phosphoinositide-mediated signaling; response to retinoic acid; fibroblast growth factor receptor signaling pathway; negative regulation of phosphatidylinositol biosynthetic process; positive regulation of protein amino acid autophosphorylation; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of protein kinase B signaling cascade; cell activation; organ morphogenesis; regulation of actin cytoskeleton organization and biogenesis; positive regulation of cell division; response to hypoxia; innate immune response; actin cytoskeleton organization and biogenesis; blood coagulation; alveolus development; positive regulation of DNA replication; positive regulation of cell migration

Research Articles on PDGFA

Similar Products

Product Notes

The PDGFA pdgfa (Catalog #AAA7114991) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 87-211aa; Full Length of Mature Protein. The amino acid sequence is listed below: SIEEAVPAVC KTRTVIYEIP RSQVDPTSAN FLIWPPCVEV KRCTGCCNTS SVKCQPSRVH HRSVKVAKVE YVRKKPKLKE VQVRLEEHLE CACATTSLNP DYREEDTGRP RESGKKRKRK RLKPT. It is sometimes possible for the material contained within the vial of "Platelet-Derived Growth Factor Subunit A (PDGFA), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.