Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Iron-Sulfur Cluster Repair Protein ytfE (ytfE) Active Protein | YTFE active protein

Recombinant Escherichia Coli Iron-Sulfur Cluster Repair Protein ytfE (ytfE) (Active)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Iron-Sulfur Cluster Repair Protein ytfE (ytfE); Recombinant Escherichia Coli Iron-Sulfur Cluster Repair Protein ytfE (ytfE) (Active); Regulator of cell morphogenesis and NO signaling; YTFE active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid or Lyophilized Powder
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, p
Sequence Positions
1-220aa; Full Length
Sequence
MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE
Sequence Length
220
Species
Escherichia coli (strain K12)
Tag
N-terminal GST-tagged
Endotoxin
Not test.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized aqpZ at 5 ug/ml can bind human ytfE, the EC50 of human ytfE protein is 197.90-259.70 ug/ml.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

SDS-Page ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Related Product Information for YTFE active protein
Di-iron-containing protein involved in the repair of iron-sulfur clusters damaged by oxidative and nitrosative stress conditions.

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51.9 kD
NCBI Official Full Name
iron-sulfur cluster repair protein YtfE
UniProt Protein Name
Iron-sulfur cluster repair protein YtfE
UniProt Gene Name
ytfE
UniProt Synonym Gene Names
RCMNS
UniProt Entry Name
YTFE_ECOLI

Uniprot Description

Di-iron-containing protein involved in the repair of iron-sulfur clusters damaged by oxidative and nitrosative stress conditions.

Similar Products

Product Notes

The YTFE ytfe (Catalog #AAA7135720) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-220aa; Full Length. The amino acid sequence is listed below: MAYRDQPLGE LALSIPRASA LFRKYDMDYC CGGKQTLARA AARKELDVEV IEAELAKLAE QPIEKDWRSA PLAEIIDHII VRYHDRHREQ LPELILQATK VERVHADKPS VPKGLTKYLT MLHEELSSHM MKEEQILFPM IKQGMGSQAM GPISVMESEH DEAGELLEVI KHTTNNVTPP PEACTTWKAM YNGINELIDD LMDHISLENN VLFPRALAGE. It is sometimes possible for the material contained within the vial of "Iron-Sulfur Cluster Repair Protein ytfE (ytfE), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.