ATP-Dependent RNA Helicase DDX19B (DDX19B) Active Protein | DDX19B active protein

Recombinant Human ATP-Dependent RNA Helicase DDX19B (DDX19B) (Active)

Cat. Num. AAA7135730

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: ATP-Dependent RNA Helicase DDX19B (DDX19B); Recombinant Human ATP-Dependent RNA Helicase DDX19B (DDX19B) (Active); DEAD box RNA helicase DEAD5DEAD box protein 19BDBP5; DDX19; TDBP; DDX19B active protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid or Lyophilized Powder; If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.; If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, p
• Sequence Positions: 2-479aa; Full Length of Mature Protein
• Sequence: ATDSWALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN
• Sequence Length: 370

• Species: Human
• Tag: N-terminal GST-tagged
• Endotoxin: Not test.
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized LCN2 at 2 ug/ml can bind human DDX19B, the EC50 of human DDX19B protein is 17.71-23.15 ug/ml.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Related Product Information for DDX19B active protein

ATP-dependent RNA helicase involved in mRNA export from the nucleus. Rather than unwinding RNA duplexes, DDX19B functions as a remodeler of ribonucleoprotein particles, whereby proteins bound to nuclear mRNA are dissociated and replaced by cytoplasmic mRNA binding proteins.

Product Categories/Family for DDX19B active protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 62241022
• NCBI Accession #: NP_001014449.1
• NCBI GenBank Nucleotide #: NP_001014449.1
• UniProt Accession #: Q9UMR2
• Molecular Weight: 80.8 kDa
• NCBI Official Full Name: ATP-dependent RNA helicase DDX19B isoform 3
• UniProt Protein Name: ATP-dependent RNA helicase DDX19B
• Protein Family: ATP-dependent RNA helicase
• UniProt Gene Name: DDX19B
• UniProt Synonym Gene Names: DBP5; DDX19; TDBP
• UniProt Entry Name: DD19B_HUMAN

Uniprot Description

DDX19B: ATP-dependent RNA helicase involved in mRNA export from the nucleus. Belongs to the DEAD box helicase family. DDX19/DBP5 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding; EC 3.6.4.13; Helicase

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: nuclear membrane; membrane; cytoplasm; nuclear envelope; nuclear pore

Molecular Function: RNA binding; helicase activity; ATP binding

Biological Process: mRNA export from nucleus; protein transport