SDS-Page
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Predicted band size: 13.9kDaObserved band size: 15kDa due to molecular structure of protein)
COVID 19 Non-structural protein 9 (nsp9) Coronavirus Recombinant Protein | COVID-19 recombinant protein
Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 (nsp9)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
COVID 19 Non-structural protein 9 (nsp9) Coronavirus; Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 (nsp9); 2019 Novel Coronavirus; Coronavirus; CoV; COVID-19 virus; HCoV-2; Human Coronavirus 2019; SARS2; SARS-CoV-2; Severe acute respiratory syndrome coronavirus 2; Non-structural protein 9 (nsp9); COVID-19 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyop
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyop
Sequence Positions
1-113aa, full length
Sequence
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Species
Human Novel Coronavirus (SARS-CoV-2/ 2019-nCoV)
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-Page
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Predicted band size: 13.9kDaObserved band size: 15kDa due to molecular structure of protein)
SDS-Page
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Predicted band size: 13.9kDaObserved band size: 15kDa due to molecular structure of protein)
Related Product Information for COVID-19 recombinant protein
The recombinant severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) non-structural protein 9 (NSP9) is a full-length protein expressed in E.coli. It contains the 1-113 amino acid sequence of human SARS-CoV-2 and carries a 10xHis-tag at the C-terminus. The purity of this NSP9 protein reaches up to 90% determined by SDS-PAGE. And it migrated to a molecular band of about 15kDa on the gel under reducing conditions. Moreover, this NSP9 protein is in stock now. In addition to being as the immunogen for specific antibodies, this recombinant NSP9 protein may also be used in the studies of microbiology. SARS-CoV-2 NSP9 is a small nonenzymatic protein that is not incorporated within the viral particles. As an RNA-binding protein, NSP9 assists with RNA-dependent RNA polymerase function, facilitating viral genomic RNA reproduction and viral replication during infection. It also mediates viral overall virulence.
NCBI and Uniprot Product Information
UniProt Accession #
Molecular Weight
13.9kDa
Similar Products
Product Notes
The COVID-19 (Catalog #AAA7136888) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-113aa, full length. The amino acid sequence is listed below: NNELSPVALR QMSCAAGTTQ TACTDDNALA YYNTTKGGRF VLALLSDLQD LKWARFPKSD GTGTIYTELE PPCRFVTDTP KGPKVKYLYF IKGLNNLNRG MVLGSLAATV RLQ. It is sometimes possible for the material contained within the vial of "COVID 19 Non-structural protein 9 (nsp9) Coronavirus, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
