Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interleukin-10 (Il10) Active Protein | Il10 active protein

Recombinant Mouse Interleukin-10 (Il10)

Gene Names
Il10; CSIF; Il-10
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-10 (Il10); Recombinant Mouse Interleukin-10 (Il10); Interleukin-10; Il10; IL-10; Cytokine synthesis inhibitory factor; CSIF; Il10 active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
Sequence Positions
19-178aa; Full Length of Mature Protein
Sequence
SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS
Sequence Length
178
Species
Mouse
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by the dose-dependent co-stimulation with murine IL-4 of MC-9 cells is less than 2 ng/ml.
Subcellular Location
Secreted
Protein Families
IL-10 Family
Classification
Cytokine
Subdivision
Interleukin
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Il10 active protein
Relevance: Mouse Il10 is the prototypic member of the IL-10 cytokine family, including IL-10, IL-19, IL-20, IL-22 (IL-TIF), IL-24 and IL-26. Many viruses encode viral members of the IL-10 family, such as Epstein-Barr virus (EBV) and human cytomegalovirus (HCMV). Its main function is inhibiting the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. Although human and mouse IL-10 are 81% identical at the nucleotide and amino acid level, mouse IL-10 is species-specific and does not act on human cells. Interestingly, Human IL-10 is active on mouse cells.

Function: Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Product Categories/Family for Il10 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18.9 kDa
NCBI Official Full Name
interleukin-10
NCBI Official Synonym Full Names
interleukin 10
NCBI Official Symbol
Il10
NCBI Official Synonym Symbols
CSIF; Il-10
NCBI Protein Information
interleukin-10
UniProt Protein Name
Interleukin-10
Protein Family
UniProt Gene Name
Il10
UniProt Synonym Gene Names
Il-10; IL-10; CSIF
UniProt Entry Name
IL10_MOUSE

NCBI Description

This gene encodes an anti-inflammatory cytokine that is a member of the class-2 cytokine family. The encoded protein is secreted by cells of both the innate and adaptive immune systems and is crucial for limiting the immune response to a broad range of pathogens. It also has been shown to suppress autoimmune responses. This protein mediates it's immunosuppressive signal through a specific interleukin 10 receptor complex. Aberrant functioning of this gene is associated with numerous immune disorders including graft-versus-host disease, and increased susceptibility to HIV-1 infection and rheumatoid arthritis. [provided by RefSeq, Sep 2015]

Uniprot Description

IL10: Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. Belongs to the IL-10 family.

Protein type: Secreted; Motility/polarity/chemotaxis; Cytokine; Secreted, signal peptide

Cellular Component: extracellular space; extracellular region

Molecular Function: cytokine activity; interleukin-10 receptor binding

Biological Process: negative regulation of chronic inflammatory response to antigenic stimulus; positive regulation of transcription, DNA-dependent; response to glucocorticoid stimulus; positive regulation of JAK-STAT cascade; negative regulation of B cell proliferation; negative regulation of membrane protein ectodomain proteolysis; positive regulation of MHC class II biosynthetic process; response to molecule of bacterial origin; negative regulation of interferon-gamma production; negative regulation of interleukin-6 production; negative regulation of tumor necrosis factor biosynthetic process; inflammatory response; negative regulation of interleukin-12 production; positive regulation of B cell apoptosis; negative regulation of myeloid dendritic cell activation; negative regulation of nitric oxide biosynthetic process; negative regulation of tumor necrosis factor production; negative regulation of cytokine secretion during immune response; regulation of gene expression; negative regulation of inflammatory response; defense response to bacterium; negative regulation of cytokine production; immune response; positive regulation of transcription factor activity; positive regulation of transcription from RNA polymerase II promoter; regulation of sensory perception of pain; receptor biosynthetic process; positive regulation of cytokine secretion; negative regulation of apoptosis

Research Articles on Il10

Similar Products

Product Notes

The Il10 il10 (Catalog #AAA7115081) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-178aa; Full Length of Mature Protein. The amino acid sequence is listed below: SRGQYSREDN NCTHFPVGQS HMLLELRTAF SQVKTFFQTK DQLDNILLTD SLMQDFKGYL GCQALSEMIQ FYLVEVMPQA EKHGPEIKEH LNSLGEKLKT LRMRLRRCHR FLPCENKSKA VEQVKSDFNK LQDQGVYKAM NEFDIFINCI EAYMMIKMKS. It is sometimes possible for the material contained within the vial of "Interleukin-10 (Il10), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.