Interleukin-10 Recombinant Protein | IL-10 recombinant protein

Recombinant Human Interleukin-10 protein

Cat. Num. AAA1265299

• Gene Names: IL10; CSIF; TGIF; GVHDS; IL-10; IL10A
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-10; Recombinant Human Interleukin-10 protein; Cytokine synthesis inhibitory factor; CSIF; IL-10 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 19-178aa; Full Length
• Sequence: SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
• Sequence Length: 178

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for IL-10 recombinant protein

Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.

Product Categories/Family for IL-10 recombinant protein

Immunology

References

Isolation and expression of human cytokine synthesis inhibitory factor cDNA clones homology to Epstein-Barr virus open reading frame BCRFI.Vieira P., de Waal-Malefyt R., Dang M.-N., Johnson K.E., Kastelein R., Fiorentino D.F., Devries J.E., Roncarolo M.-G., Mosmann T.R., Moore K.W.Proc. Natl. Acad. Sci. U.S.A. 88:1172-1176(1991) The structure of the human IL-10 gene.Sanjanwala B., de Waal-Malefyt R.Cloning, sequencing of human interleukin-10 cDNA and construction of its eukaryotic expression vector.Dai W.-J., Jiang H.-C., Pan S.-H.Haerbin Yi Ke Da Xue Xue Bao 35:4-6(2001) SeattleSNPs variation discovery resourceIdentification of functional domains on human interleukin 10.Gesser B., Leffers H., Jinquan T., Vestergaard C., Kirstein N., Sindet-Pedersen S., Jensen S.L., Thestrup-Pedersen K., Larsen C.G.Proc. Natl. Acad. Sci. U.S.A. 94:14620-14625(1997) Signal peptide prediction based on analysis of experimentally verified cleavage sites.Zhang Z., Henzel W.J.Protein Sci. 13:2819-2824(2004) Disulfide bond assignments and secondary structure analysis of human and murine interleukin 10.Windsor W.T., Syto R., Tsarbopoulos A., Zhang R., Durkin J., Baldwin S., Paliwal S., Mui P.W., Pramanik B., Trotta P.P.Biochemistry 32:8807-8815(1993) Relation of an interleukin-10 promoter polymorphism to graft-versus-host disease and survival after hematopoietic-cell transplantation.Lin M.T., Storer B., Martin P.J., Tseng L.H., Gooley T., Chen P.J., Hansen J.A.N. Engl. J. Med. 349:2201-2210(2003) Crystal structure of interleukin 10 reveals an interferon gamma-like fold.Walter M.R., Nagabhushan T.L.Biochemistry 34:12118-12125(1995) Crystal structure of interleukin-10 reveals the functional dimer with an unexpected topological similarity to interferon gamma.Zdanov A., Schalk-Hihi C., Gustchina A., Tsang M., Wheatherbee J., Wlodawer A.Structure 3:591-601(1995) Crystal structure of human interleukin-10 at 1.6-A resolution and a model of a complex with its soluble receptor.Zdanov A., Schalk-Hihi C., Wlodawer A.Protein Sci. 5:1955-1962(1996) Crystal structure of the IL-10/IL-10R1 complex reveals a shared receptor binding site.Josephson K., Logsdon N.J., Walter M.R.Immunity 15:35-46(2001) Same structure, different function crystal structure of the Epstein-Barr virus IL-10 bound to the soluble IL-10R1 chain.Yoon S.I., Jones B.C., Logsdon N.J., Walter M.R.Structure 13:551-564(2005) A Gly15Arg mutation in the interleukin-10 gene reduces secretion of interleukin-10 in Crohn disease.van der Linde K., Boor P.P., Sandkuijl L.A., Meijssen M.A., Savelkoul H.F., Wilson J.H., de Rooij F.W.Scand. J. Gastroenterol. 38:611-617(2003)

NCBI and Uniprot Product Information

• NCBI GI #: 10835141
• NCBI GeneID: 3586
• NCBI Accession #: NP_000563.1
• NCBI GenBank Nucleotide #: NM_000572.2
• UniProt Accession #: P22301
• Molecular Weight: 45.6 kDa
• NCBI Official Full Name: interleukin-10
• NCBI Official Synonym Full Names: interleukin 10
• NCBI Official Symbol: IL10
• NCBI Official Synonym Symbols: CSIF; TGIF; GVHDS; IL-10; IL10A
• NCBI Protein Information: interleukin-10
• UniProt Protein Name: Interleukin-10
• Protein Family: Interleukin
• UniProt Gene Name: IL10
• UniProt Synonym Gene Names: IL-10; CSIF
• UniProt Entry Name: IL10_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. Mutations in this gene are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis.[provided by RefSeq, May 2011]

Uniprot Description

IL10: Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. Belongs to the IL-10 family.

Protein type: Secreted; Cytokine; Secreted, signal peptide; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 1q31-q32

Cellular Component: cytoplasm; extracellular space

Molecular Function: cytokine activity; growth factor activity; interleukin-10 receptor binding; protein binding

Biological Process: aging; B cell differentiation; B cell proliferation; cell-cell signaling; cytoplasmic sequestering of NF-kappaB; defense response to bacterium; defense response to protozoan; hemopoiesis; inflammatory response; leukocyte chemotaxis; negative regulation of apoptosis; negative regulation of B cell proliferation; negative regulation of chronic inflammatory response to antigenic stimulus; negative regulation of cytokine secretion during immune response; negative regulation of interferon-alpha biosynthetic process; negative regulation of interferon-gamma production; negative regulation of interleukin-1 production; negative regulation of interleukin-12 production; negative regulation of interleukin-18 production; negative regulation of interleukin-6 production; negative regulation of interleukin-8 production; negative regulation of membrane protein ectodomain proteolysis; negative regulation of MHC class II biosynthetic process; negative regulation of myeloid dendritic cell activation; negative regulation of nitric oxide biosynthetic process; negative regulation of T cell proliferation; negative regulation of tumor necrosis factor biosynthetic process; negative regulation of tumor necrosis factor production; positive regulation of B cell apoptosis; positive regulation of cytokine secretion; positive regulation of JAK-STAT cascade; positive regulation of MHC class II biosynthetic process; positive regulation of transcription factor activity; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; receptor biosynthetic process; regulation of gene expression; regulation of isotype switching; regulation of sensory perception of pain; response to activity; response to drug; response to glucocorticoid stimulus; response to inactivity; response to insulin stimulus; response to molecule of bacterial origin; T-helper 2 type immune response

Disease: Graft-versus-host Disease, Susceptibility To; Human Immunodeficiency Virus Type 1, Susceptibility To; Rheumatoid Arthritis