Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: OXTSample Tissue: Human JurkatAntibody Dilution: 1ug/ml)

Rabbit OXT Polyclonal Antibody | anti-OXT antibody

OXT antibody - N-terminal region

Gene Names
OXT; OT; OT-NPI; OXT-NPI
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
OXT; Polyclonal Antibody; OXT antibody - N-terminal region; anti-OXT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCA
Sequence Length
125
Applicable Applications for anti-OXT antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 92%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 93%; Sheep: 85%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: OXTSample Tissue: Human JurkatAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: OXTSample Tissue: Human JurkatAntibody Dilution: 1ug/ml)
Related Product Information for anti-OXT antibody
This is a rabbit polyclonal antibody against OXT. It was validated on Western Blot

Target Description: There are two proteins encoded by this gene, oxytocin and neurophysin I. Oxytocin is posterior pituitary hormone which is synthesized as an inactive precursor in the hypothalamus along with its carrier protein neurophysin I. Together with neurophysin, it is packaged into neurosecretory vesicles and transported axonally to the nerve endings in the neurohypophysis, where it is either stored or secreted into the bloodstream. The precursor seems to be activated while it is being transported along the axon to the posterior pituitary. This hormone contracts smooth muscle during parturition and lactation. It is also involved in cognition, tolerance, adaptation and complex sexual and maternal behaviour, as well as in the regulation of water excretion and cardiovascular functions.
Product Categories/Family for anti-OXT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9kDa
NCBI Official Full Name
oxytocin-neurophysin 1 preproprotein
NCBI Official Synonym Full Names
oxytocin/neurophysin I prepropeptide
NCBI Official Symbol
OXT
NCBI Official Synonym Symbols
OT; OT-NPI; OXT-NPI
NCBI Protein Information
oxytocin-neurophysin 1
UniProt Protein Name
Oxytocin-neurophysin 1
Protein Family
UniProt Gene Name
OXT
UniProt Synonym Gene Names
OT; OT-NPI
UniProt Entry Name
NEU1_HUMAN

NCBI Description

This gene encodes a precursor protein that is processed to produce oxytocin and neurophysin I. Oxytocin is a posterior pituitary hormone which is synthesized as an inactive precursor in the hypothalamus along with its carrier protein neurophysin I. Together with neurophysin, it is packaged into neurosecretory vesicles and transported axonally to the nerve endings in the neurohypophysis, where it is either stored or secreted into the bloodstream. The precursor seems to be activated while it is being transported along the axon to the posterior pituitary. This hormone contracts smooth muscle during parturition and lactation. It is also involved in cognition, tolerance, adaptation and complex sexual and maternal behaviour, as well as in the regulation of water excretion and cardiovascular functions. [provided by RefSeq, Dec 2013]

Uniprot Description

OXT: Neurophysin 1 specifically binds oxytocin. Belongs to the vasopressin/oxytocin family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 20p13

Cellular Component: extracellular space; extracellular region; terminal button; secretory granule

Molecular Function: oxytocin receptor binding; neurohypophyseal hormone activity

Biological Process: response to peptide hormone stimulus; response to cAMP; male mating behavior; heart development; drinking behavior; response to glucocorticoid stimulus; positive regulation of female receptivity; female pregnancy; signal transduction; positive regulation of synaptic transmission; response to estradiol stimulus; elevation of cytosolic calcium ion concentration; hyperosmotic salinity response; negative regulation of blood pressure; response to electrical stimulus; response to food; grooming behavior; response to retinoic acid; maternal behavior; regulation of heart rate; eating behavior; response to amphetamine; social behavior; sleep; response to ether; response to cocaine; memory; positive regulation of ossification; response to sucrose stimulus; positive regulation of synaptogenesis; positive regulation of prostaglandin secretion; sperm ejaculation; response to activity; regulation of sensory perception of pain; response to progesterone stimulus; positive regulation of blood pressure

Research Articles on OXT

Similar Products

Product Notes

The OXT oxt (Catalog #AAA3206060) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OXT antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's OXT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OXT oxt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGLLALTSAC YIQNCPLGGK RAAPDLDVRK CLPCGPGGKG RCFGPNICCA. It is sometimes possible for the material contained within the vial of "OXT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.