Fibroblast Growth Factor 1 (Fgf1) Active Protein | Fgf1 active protein

Recombinant Mouse Fibroblast Growth Factor 1 (Fgf1)

Cat. Num. AAA7115012

• Gene Names: Fgf1; Fam; Fgfa; Dffrx; Fgf-1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Fibroblast Growth Factor 1 (Fgf1); Recombinant Mouse Fibroblast Growth Factor 1 (Fgf1); Fibroblast Growth Factor 1; FGF-1; Acidic Fibroblast Growth Factor; aFGF; Heparin-Binding Growth Factor 1; HBGF-1; Fgf1; Fgf-1; Fgfa; Fgf1 active protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM Tris-HCl, 500 mM NaCl, pH 6.6
• Sequence Positions: 16-155aa; Full Length of Mature Protein
• Sequence: FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
• Sequence Length: 155

• Species: Mouse
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by the dose-dependent stimulation of thymidine uptake by 3T3 cells in the presence of Heparin is less than 1.6 ng/mL.
• Subcellular Location: Secreted, Cytoplasm, Cytoplasm, Cell Cortex, Cytoplasm, Cytosol, Nucleus
• Protein Families: Heparin-Binding Growth Factors Family
• Classification: Cytokine
• Subdivision: Growth Factor
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for Fgf1 active protein

Relevance: FGF acidic is a 17 kDa nonglycosylated member of the FGF family of mitogenic peptides. FGF acidic, which is produced by multiple cell types, stimulates the proliferation of all cells of mesodermal origin and many cells of neuroectodermal, ectodermal, and endodermal origin. It plays a number of roles in development, regeneration, and angiogenesis. FGF-acidic is a non-glycosylated heparin binding growth factor that is expressed in the brain, kidney, retina, smooth muscle cells, bone matrix, osteoblasts, astrocytes and endothelial cells. FGF-acidic has the ability to signal through all the FGF receptors.

Function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV.

Product Categories/Family for Fgf1 active protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 6753850
• NCBI GeneID: 14164
• NCBI Accession #: NP_034327.1
• NCBI GenBank Nucleotide #: NM_010197.3
• UniProt Accession #: P61148
• Molecular Weight: 15.7 kDa
• NCBI Official Full Name: fibroblast growth factor 1
• NCBI Official Synonym Full Names: fibroblast growth factor 1
• NCBI Official Symbol: Fgf1
• NCBI Official Synonym Symbols: Fam; Fgfa; Dffrx; Fgf-1
• NCBI Protein Information: fibroblast growth factor 1
• UniProt Protein Name: Fibroblast growth factor 1
• Protein Family: Fibroblast growth factor
• UniProt Gene Name: Fgf1
• UniProt Synonym Gene Names: Fgf-1; Fgfa; FGF-1; aFGF; HBGF-1
• UniProt Entry Name: FGF1_MOUSE

Uniprot Description

FGF1: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Monomer. Homodimer. Interacts with FGFR1, FGFR2, FGFR3 and FGFR4. Affinity between fibroblast growth factors (FGFs) and their receptors is increased by heparan sulfate glycosaminoglycans that function as coreceptors. Found in a complex with FGFBP1, FGF1 and FGF2. Interacts with FGFBP1. Part of a Cu(2+)-dependent multiprotein aggregate containing FGF1, S100A13 and SYT1. Interacts with SYT1. Interacts with S100A13. Belongs to the heparin-binding growth factors family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; Cytokine; Motility/polarity/chemotaxis

Cellular Component: nucleoplasm; extracellular space; proteinaceous extracellular matrix; cytoplasm; nucleolus; extracellular region; nucleus; cytosol

Molecular Function: heparin binding; protein binding; growth factor activity; Hsp70 protein binding; receptor binding; fibroblast growth factor receptor binding

Biological Process: fibroblast growth factor receptor signaling pathway; positive regulation of transcription, DNA-dependent; multicellular organismal development; positive regulation of cholesterol biosynthetic process; cardiac muscle cell proliferation; positive regulation of MAP kinase activity; cell proliferation; positive regulation of angiogenesis; induction of an organ; positive regulation of cell division; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of protein amino acid phosphorylation; angiogenesis; cell differentiation; positive regulation of epithelial cell proliferation; lung development; positive regulation of cell migration