Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Fibroblast growth factor 1 Recombinant Protein | Fgf1 recombinant protein

Recombinant Mouse Fibroblast growth factor 1

Gene Names
Fgf1; Fam; Fgfa; Dffrx; Fgf-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fibroblast growth factor 1; Recombinant Mouse Fibroblast growth factor 1; Acidic fibroblast growth factor; aFGF; Heparin-binding growth factor 1; HBGF-1; Fgf1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
16-155aa; Full Length
Sequence
FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Sequence Length
155
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for Fgf1 recombinant protein
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro.
References
Isolation of cDNAs encoding four mouse FGF family members and characterization of their expression patterns during embryogenesis.Hebert J.M., Basilico C., Goldfarb M., Haub O., Martin G.R.Dev. Biol. 138:454-463(1990) Cloning and characterization of the mouse Fgf-1 gene.Madiai F., Hackshaw K.V., Chiu I.M.Gene 179:231-236(1996) Characterization of the 1B promoter of fibroblast growth factor 1 and its expression in the adult and developing mouse brain.Alam K.Y., Frostholm A., Hackshaw K.V., Evans J.E., Rotter A., Chiu I.M.J. Biol. Chem. 271:30263-30271(1996)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19.8 kDa
NCBI Official Full Name
fibroblast growth factor 1
NCBI Official Synonym Full Names
fibroblast growth factor 1
NCBI Official Symbol
Fgf1
NCBI Official Synonym Symbols
Fam; Fgfa; Dffrx; Fgf-1
NCBI Protein Information
fibroblast growth factor 1
UniProt Protein Name
Fibroblast growth factor 1
Protein Family
UniProt Gene Name
Fgf1
UniProt Synonym Gene Names
Fgf-1; Fgfa; FGF-1; aFGF; HBGF-1
UniProt Entry Name
FGF1_MOUSE

Uniprot Description

FGF1: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Monomer. Homodimer. Interacts with FGFR1, FGFR2, FGFR3 and FGFR4. Affinity between fibroblast growth factors (FGFs) and their receptors is increased by heparan sulfate glycosaminoglycans that function as coreceptors. Found in a complex with FGFBP1, FGF1 and FGF2. Interacts with FGFBP1. Part of a Cu(2+)-dependent multiprotein aggregate containing FGF1, S100A13 and SYT1. Interacts with SYT1. Interacts with S100A13. Belongs to the heparin-binding growth factors family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; Cytokine; Motility/polarity/chemotaxis

Cellular Component: cytoplasm; cytosol; extracellular region; extracellular space; nucleolus; nucleoplasm; nucleus; proteinaceous extracellular matrix

Molecular Function: fibroblast growth factor receptor binding; growth factor activity; heparin binding; Hsp70 protein binding; protein binding; receptor binding

Biological Process: angiogenesis; cardiac muscle cell proliferation; cell differentiation; cell proliferation; fibroblast growth factor receptor signaling pathway; induction of an organ; lung development; multicellular organismal development; positive regulation of angiogenesis; positive regulation of cell division; positive regulation of cell migration; positive regulation of cell proliferation; positive regulation of cholesterol biosynthetic process; positive regulation of epithelial cell proliferation; positive regulation of MAP kinase activity; positive regulation of protein amino acid phosphorylation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent

Research Articles on Fgf1

Similar Products

Product Notes

The Fgf1 fgf1 (Catalog #AAA961971) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 16-155aa; Full Length. The amino acid sequence is listed below: FNLPLGNYKK PKLLYCSNGG HFLRILPDGT VDGTRDRSDQ HIQLQLSAES AGEVYIKGTE TGQYLAMDTE GLLYGSQTPN EECLFLERLE ENHYNTYTSK KHAEKNWFVG LKKNGSCKRG PRTHYGQKAI LFLPLPVSSD. It is sometimes possible for the material contained within the vial of "Fibroblast growth factor 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.