Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Eotaxin-2 Active Protein | CCL24 active protein

Recombinant Human Eotaxin-2 (CCL24)

Gene Names
CCL24; Ckb-6; MPIF2; MPIF-2; SCYA24
Purity
Greater than 97.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Synonyms
Eotaxin-2; Recombinant Human Eotaxin-2 (CCL24); Eotaxin 2 Human; Eotaxin-2 Human Recombinant (CCL24); C-C motif chemokine 24; Small-inducible cytokine A24; Myeloid progenitor inhibitory factor 2; CK-beta-6; Eosinophil chemotactic protein 2; CCL24; Ckb-6; MPIF2; MPIF-2; SCYA24; Eotaxin2; CCL-24; Eotaxin 2; CCL24 active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater than 97.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form/Format
The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA
Sequence Length
119
Solubility
It is recommended to reconstitute the lyophilized CCL24 Human Recombinant in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity
The activity is determined by the chemoattract of human PBE (peripheral blood eosinophils) at a concentration between 50-100 ng/ml corresponding to a Specific Activity of 10,000-20,000IU/mg.
Preparation and Storage
Lyophilized Eotaxin-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution CCL24 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Related Product Information for CCL24 active protein
Description: CCL24 Human Recombinant produced in E Coli is a single, non-glycosylated polypeptide chain containing 78 amino acids and having a molecular mass of 8.8 kDa. The CCL24 is purified by proprietary chromatographic techniques.

Introduction: Eotaxin-2, also called MPIF2 & Ckb6, is a novel CC chemokine produced by activated monocytes and T lymphocytes. Eotaxin-2 selectively chemoattracts cells expressing CCR3 including eosinophils, basophils, Th2 T cells, mast cells, and certain subsets of dendritic cells. Furthermore, Eotaxin-2 inhibits the proliferation of multipotential hematopoietic progenitor cells. The mature protein, which includes C-terminal truncation, contains 78 amino acids (92 amino acids for the mouse homolog, without C-terminal truncation).CCL24 functions as a chemotactic chemokine for resting t-lymphocytes, and eosinophils. CCL24 has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. CCL24 is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line and binds to CCR3.
Product Categories/Family for CCL24 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,134 Da
NCBI Official Full Name
C-C motif chemokine 24
NCBI Official Synonym Full Names
chemokine (C-C motif) ligand 24
NCBI Official Symbol
CCL24
NCBI Official Synonym Symbols
Ckb-6; MPIF2; MPIF-2; SCYA24
NCBI Protein Information
C-C motif chemokine 24; CK-beta-6; eosinophil chemotactic protein 2; eotaxin-2; myeloid progenitor inhibitory factor 2; small inducible cytokine subfamily A (Cys-Cys), member 24; small-inducible cytokine A24
UniProt Protein Name
C-C motif chemokine 24
Protein Family
UniProt Gene Name
CCL24
UniProt Synonym Gene Names
MPIF2; SCYA24; MPIF-2
UniProt Entry Name
CCL24_HUMAN

NCBI Description

This gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity on resting T lymphocytes, a minimal activity on neutrophils, and is negative on monocytes and activated T lymphocytes. The protein is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. [provided by RefSeq, Jul 2008]

Uniprot Description

CCL24: Chemotactic for resting T-lymphocytes, and eosinophils. Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. Binds to CCR3. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Secreted, signal peptide; Secreted; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: extracellular space

Molecular Function: chemokine activity

Biological Process: cytoskeleton organization and biogenesis; signal transduction; chemotaxis; regulation of cell shape; positive regulation of angiogenesis; cell-cell signaling; positive regulation of actin filament polymerization; eosinophil chemotaxis; immune response; positive regulation of endothelial cell proliferation; inflammatory response; positive regulation of cell migration; positive regulation of inflammatory response

Research Articles on CCL24

Similar Products

Product Notes

The CCL24 ccl24 (Catalog #AAA143273) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: VVIPSPCCMF FVSKRIPENR VVSYQLSSRS TCLKGGVIFT TKKGQQFCGD PKQEWV QRYMKNLDAK QKKASPRARA VA. It is sometimes possible for the material contained within the vial of "Eotaxin-2, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.