CSNK1A1 Polyclonal Antibody | anti-CSNK1A1 antibody

Anti-CSNK1A1 Antibody

Cat. Num. AAA178210

• Gene Names: CSNK1A1; CK1; CK1a; CKIa; HLCDGP1; PRO2975; HEL-S-77p
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: CSNK1A1; Polyclonal Antibody; Anti-CSNK1A1 Antibody; Casein kinase I isoform alpha; Casein kinase 1 alpha 1; CK1; CK1A; CKI alpha; CKI-alpha; CKIa; Clock regulator kinase; Csnk1a1; Down regulated in lung cancer; HLCDGP1; KC1A_HUMAN; PRO2975; casein kinase 1; alpha 1; anti-CSNK1A1 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 365

• Applicable Applications for anti-CSNK1A1 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CSNK1A1 (30-68aa DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ), identical to the related mouse and rat sequences.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- CSNK1A1 Picoband antibody, MBS178210, Western blottingAll lanes: Anti CSNK1A1 (MBS178210) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Kidney Tissue Lysate at 50ugLane 3: Mouse Kidney Tissue Lysate at 50ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 39KDObserved bind size: 39KD)

Immunohistochemistry (IHC)

(Anti- CSNK1A1 Picoband antibody, MBS178210,IHC(P)IHC(P): Mouse Intestine Tissue )

Immunohistochemistry (IHC)

(Anti- CSNK1A1 Picoband antibody, MBS178210,IHC(P)IHC(P): Rat Intestine Tissue )

Immunohistochemistry (IHC)

(Anti- CSNK1A1 Picoband antibody, MBS178210,IHC(P)IHC(P): Human Intestinal Cancer Tissue )

Related Product Information for anti-CSNK1A1 antibody

Description: Rabbit IgG polyclonal antibody for Casein kinase I isoform alpha(CSNK1A1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Casein kinase I isoform alpha is an enzyme that in humans is encoded by the CSNK1A1 gene. The CSNK1A1 gene is mapped to chromosome 5q32 based on an alignment of the CSNK1A1 sequence with the genomic sequence (GRCh37). It is reported that both screens identified CK1-alpha as a bifunctional regulator of NF-kappa-B. CK1-alpha dynamically associates with the CBM complex on T cell receptor engagement to participate in cytokine production and lymphocyte proliferation. However, CK1-alpha kinase activity has a contrasting role by subsequently promoting the phosphorylation and inactivation of CARMA1. CK1-alpha has thus a dual 'gating' function which first promotes and then terminates receptor-induced NF-kappa-B. ABC DLBCL cells required CK1-alpha for constitutive NF-kappa-B activity, indicating that CK1-alpha functions as a conditionally essential malignancy gene. 

References

1. Bidere, N., Ngo, V. N., Lee, J., Collins, C., Zheng, L., Wan, F., Davis, R. E., Lenz, G., Anderson, D. E., Arnoult, D., Vazquez, A., Sakai, K., Zhang, J., Meng, Z., Veenstra, T. D., Staudt, L. M., Lenardo, M. J. Casein kinase 1-alpha governs antigen-receptor-induced NF-kappa-B activation and human lymphoma cell survival. Nature 458: 92-96, 2009. 2. Elyada, E., Pribluda, A., Goldstein, R. E., Morgenstern, Y., Brachya, G., Cojocaru, G., Snir-Alkalay, I., Burstain, I., Haffner-Krausz, R., Jung, S., Wiener, Z., Alitalo, K., Oren, M., Pikarsky, E., Ben-Neriah, Y. CKI-alpha ablation highlights a critical role for p53 in invasiveness control. Nature 470: 409-413, 2011. 3. Tapia C, Featherstone T, Gómez C, Taillon-Miller P, Allende CC, Allende JE (Aug 1994). "Cloning and chromosomal localization of the gene coding for human protein kinase CK1". FEBS Letters 349 (2): 307-12.

NCBI and Uniprot Product Information

• NCBI GI #: 68303575
• NCBI GeneID: 1452
• NCBI Accession #: NP_001020276.1
• NCBI GenBank Nucleotide #: NM_001025105.2
• UniProt Accession #: P48729; Q4JJA0; Q5U046; Q5U047; Q6FGA2; Q71TU5; Q96HD2; Q9UDK3; D3DQG0; D3DQG1
• Molecular Weight: 37,567 Da
• NCBI Official Full Name: casein kinase I isoform alpha isoform 1
• NCBI Official Synonym Full Names: casein kinase 1 alpha 1
• NCBI Official Symbol: CSNK1A1
• NCBI Official Synonym Symbols: CK1; CK1a; CKIa; HLCDGP1; PRO2975; HEL-S-77p
• NCBI Protein Information: casein kinase I isoform alpha
• UniProt Protein Name: Casein kinase I isoform alpha
• Protein Family: Casein kinase
• UniProt Gene Name: CSNK1A1
• UniProt Synonym Gene Names: CKI-alpha
• UniProt Entry Name: KC1A_HUMAN

Uniprot Description

CK1A: an ubiquitous protein kinase of the CK1 family. Participates in Wnt signaling. Phosphorylates beta catenin, marking it for beta-TRCp-mediated ubiquitinylation and proteasomal degradation.

Protein type: Protein kinase, CK1; EC 2.7.11.1; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); CK1 group; CK1 family

Chromosomal Location of Human Ortholog: 5q32

Cellular Component: beta-catenin destruction complex; centrosome; cytosol; keratin filament; membrane; mRNA cleavage and polyadenylation specificity factor complex; nuclear speck

Molecular Function: ATP binding; kinase activity; protein binding; protein kinase activity; protein serine/threonine kinase activity

Biological Process: cell division; cell surface receptor linked signal transduction; Golgi organization and biogenesis; intermediate filament cytoskeleton organization and biogenesis; mitosis; peptidyl-serine phosphorylation; phagocytosis; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; proteasomal ubiquitin-dependent protein catabolic process; protein amino acid phosphorylation; regulation of cell shape; signal transduction; Wnt receptor signaling pathway