Type III iodothyronine deiodinase Recombinant Protein | IOD3 recombinant protein

Recombinant Rat Type III iodothyronine deiodinase

Cat. Num. AAA9422645

• Gene Names: Dio3; 5DIII; DIOIII
• Reactivity: Rat
• Purity: Greater than 90% as determined by SDS-PAGE.
• Synonyms: Type III iodothyronine deiodinase; Recombinant Rat Type III iodothyronine deiodinase; 5DIII; DIOIII; Type 3 DI; Type-III 5'-deiodinase; IOD3 recombinant protein

• Host: Yeast
• Reactivity: Rat
• Purity/Purification: Greater than 90% as determined by SDS-PAGE.
• Form/Format: 20mM Tris-HCl based buffer, pH8.0
• Sequence Positions: : 37-271aa(U132S); Partial, provide the complete extracellular domain.
• Sequence: DFQCIRRRVLLTAREESTAEHEDPPLCVSDSNRMCTVESLRAVWHGQKLDYFKSAHLGCSAPNTEVVMLEGRRLCKILDFSQGKRPLVVNFGSCTSPPFMARLQAYRRLAAQH VGIADFLLVYIEEAHPSDGWLSTDASYQIPQHQCLQDRLAAAQLMLQGAPGCRVVVDTMDNSSNAAYGAYFERLYIVLEGKVVYQGGRGPEGYKISELRMWLEQYQQGLMGTK GSGQVVIQV

• Tag information: EP, YP, BP, MP: Tag type will be determined during the manufacturing process.; ; The expected tag for each expression system is list as follows: ; YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Tag Info: N-terminal 6xHis-tagged
• Note: The amino acid at position 132 is originally a "U", which has already been mutated to be "S" in the above sequence. This is due to the "U", or selenocysteine, which is encoded by UGA, is normally used as a stop codon in prokaryotic cells. Thus leading to early termination of translation. So we have substituted this "U" to simply be an "S" so that translation can proceed. Changing to cysteine may result in undesired disulfide bond formation, so serine is chosen since it is structurally related to both selenocysteine and cysteine.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for IOD3 recombinant protein

Responsible for the deiodination of T4 (3, 5, 3', 5'-tetraiodothyronine) into RT3 (3, 3', 5'-triiodothyronine) and of T3 (3, 5, 3'-triiodothyronine) into T2 (3, 3'-diiodothyronine). RT3 and T2 are inactive metabolites. May play a role in preventing prature exposure of developing fetal tissues to adult levels of thyroid hormones. Can regulate circulating fetal thyroid hormone concentrations throughout gestation. Essential role for regulation of thyroid hormone inactivation during bryological development.

NCBI and Uniprot Product Information

• NCBI GI #: 255982585
• NCBI GeneID: 29475
• NCBI Accession #: NP_058906.3
• NCBI GenBank Nucleotide #: NM_017210.4
• UniProt Accession #: P49897
• Molecular Weight: 29.4kD
• NCBI Official Full Name: thyroxine 5-deiodinase
• NCBI Official Synonym Full Names: iodothyronine deiodinase 3
• NCBI Official Symbol: Dio3
• NCBI Official Synonym Symbols: 5DIII; DIOIII
• NCBI Protein Information: thyroxine 5-deiodinase
• UniProt Protein Name: Thyroxine 5-deiodinase
• UniProt Gene Name: Dio3
• UniProt Synonym Gene Names: Itdi3; Txdi3

NCBI Description

This is an intronless, imprinted gene that is preferentially expressed from the paternal allele. The encoded protein belongs to the iodothyronine deiodinase family, and catalyzes the inactivation of thyroid hormone by inner ring deiodination of the prohormone thyroxine (T4) and the bioactive hormone 3,3',5-triiodothyronine (T3) to inactive metabolites, 3,3',5' triiodothyronine (RT3) and 3,3'-diiodothyronine (T2), respectively. It is highly expressed in placenta, fetal and neonatal tissues, and thought to prevent premature exposure of developing fetal tissues to adult levels of thyroid hormones. It thus plays a critical role in mammalian development by regulating circulating fetal thyroid hormone concentration. This protein is a selenoprotein, containing the rare selenocysteine (Sec) amino acid at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. [provided by RefSeq, Jun 2016]

Uniprot Description

DIO3: Responsible for the deiodination of T4 (3,5,3',5'- tetraiodothyronine) into RT3 (3,3',5'-triiodothyronine) and of T3 (3,5,3'-triiodothyronine) into T2 (3,3'-diiodothyronine). RT3 and T2 are inactive metabolites. May play a role in preventing premature exposure of developing fetal tissues to adult levels of thyroid hormones. Can regulate circulating fetal thyroid hormone concentrations throughout gestation. Essential role for regulation of thyroid hormone inactivation during embryological development. Belongs to the iodothyronine deiodinase family.

Protein type: EC 1.97.1.11; Membrane protein, integral; Oxidoreductase

Chromosomal Location of Human Ortholog: 6q32

Molecular Function: thyroxine 5'-deiodinase activity; thyroxine 5-deiodinase activity

Biological Process: apoptosis; positive regulation of multicellular organism growth; response to hypoxia; retinal cone cell development; thyroid hormone catabolic process; thyroid hormone metabolic process