Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Sequence Information (The original sequence contains one "U" (red arrow) that has already been mutated to "S" in the sequence which will be used to express the corresponding recombinant protein. Explanation The "U" selenocysteine is encoded by UGA and is normally used as a stop codon in prokaryotic cells, which will lead to early termination of translation, so we will mutate this selenocysteine; In terms of the formation of selenocysteine , selenocysteine is actually a derivative of serine. Selenocysteine and cysteine as well as serine are highly similar. This selenocysteine can be regarded as either the "S" of cysteine replaced by Se, or the "O" of serine replaced by Se, and it can mutated to be serine or cysteine. Generally, we mutate it to serine considering from protein expression (because if mutating to cysteine, additional disulfide bonds may form, thus affecting the expression and structure of the protein))

Type III iodothyronine deiodinase (DIO3) Recombinant Protein | DIO3 recombinant protein

Recombinant Human Type III iodothyronine deiodinase (DIO3), partial

Gene Names
DIO3; D3; 5DIII; TXDI3; DIOIII
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Type III iodothyronine deiodinase (DIO3); Recombinant Human Type III iodothyronine deiodinase (DIO3); partial; DIO3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
68-304 aa (The original sequence contains one ‘U’ at the 170 site that has already been mutated to "S" in the recombinant MBS115899 protein, please refer to the sequence image and legend for details.)
Sequence
RKHFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCTSPPFMARMSAFQRLVTKYQRDVDFLIIYIEEAHPSDGWVTTDSPYIIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGYQVSELRTWLERYDEQLHGARPRRV
Sequence Length
304
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Sequence Information

(The original sequence contains one "U" (red arrow) that has already been mutated to "S" in the sequence which will be used to express the corresponding recombinant protein. Explanation The "U" selenocysteine is encoded by UGA and is normally used as a stop codon in prokaryotic cells, which will lead to early termination of translation, so we will mutate this selenocysteine; In terms of the formation of selenocysteine , selenocysteine is actually a derivative of serine. Selenocysteine and cysteine as well as serine are highly similar. This selenocysteine can be regarded as either the "S" of cysteine replaced by Se, or the "O" of serine replaced by Se, and it can mutated to be serine or cysteine. Generally, we mutate it to serine considering from protein expression (because if mutating to cysteine, additional disulfide bonds may form, thus affecting the expression and structure of the protein))

Sequence Information (The original sequence contains one "U" (red arrow) that has already been mutated to "S" in the sequence which will be used to express the corresponding recombinant protein. Explanation The "U" selenocysteine is encoded by UGA and is normally used as a stop codon in prokaryotic cells, which will lead to early termination of translation, so we will mutate this selenocysteine; In terms of the formation of selenocysteine , selenocysteine is actually a derivative of serine. Selenocysteine and cysteine as well as serine are highly similar. This selenocysteine can be regarded as either the "S" of cysteine replaced by Se, or the "O" of serine replaced by Se, and it can mutated to be serine or cysteine. Generally, we mutate it to serine considering from protein expression (because if mutating to cysteine, additional disulfide bonds may form, thus affecting the expression and structure of the protein))
Related Product Information for DIO3 recombinant protein
The protein encoded by this intronless gene belongs to the iodothyronine deiodinase family. It catalyzes the inactivation of thyroid hormone by inner ring deiodination of the prohormone thyroxine (T4) and the bioactive hormone 3,3 ,5-triiodothyronine (T3) to inactive metabolites, 3,3 ,5 -triiodothyronine (RT3) and 3,3 -diiodothyronine (T2), respectively. This enzyme is highly expressed in the pregnant uterus, placenta, fetal and neonatal tissues, suggesting that it plays an essential role in the regulation of thyroid hormone inactivation during embryological development. This protein contains a selenocysteine (Sec) residue, which is essential for efficient enzyme activity. The selenocysteine is encoded by the UGA codon, which normally signals translation termination. The 3 UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,947 Da
NCBI Official Full Name
thyroxine 5-deiodinase
NCBI Official Synonym Full Names
iodothyronine deiodinase 3
NCBI Official Symbol
DIO3
NCBI Official Synonym Symbols
D3; 5DIII; TXDI3; DIOIII
NCBI Protein Information
thyroxine 5-deiodinase
UniProt Protein Name
Thyroxine 5-deiodinase
Protein Family
UniProt Gene Name
DIO3
UniProt Synonym Gene Names
ITDI3; TXDI3

NCBI Description

The protein encoded by this intronless gene belongs to the iodothyronine deiodinase family. It catalyzes the inactivation of thyroid hormone by inner ring deiodination of the prohormone thyroxine (T4) and the bioactive hormone 3,3',5-triiodothyronine (T3) to inactive metabolites, 3,3',5'-triiodothyronine (RT3) and 3,3'-diiodothyronine (T2), respectively. This enzyme is highly expressed in pregnant uterus, placenta, fetal and neonatal tissues, and thought to prevent premature exposure of developing fetal tissues to adult levels of thyroid hormones. It regulates circulating fetal thyroid hormone concentrations, and thus plays a critical role in mammalian development. Knockout mice lacking this gene exhibit abnormalities related to development and reproduction, and increased activity of this enzyme in infants with hemangiomas causes severe hypothyroidism. This protein is a selenoprotein, containing the rare selenocysteine (Sec) amino acid at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. [provided by RefSeq, May 2016]

Uniprot Description

Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into RT3 (3,3',5'-triiodothyronine) and of T3 (3,5,3'-triiodothyronine) into T2 (3,3'-diiodothyronine). RT3 and T2 are inactive metabolites. May play a role in preventing premature exposure of developing fetal tissues to adult levels of thyroid hormones. Can regulate circulating fetal thyroid hormone concentrations throughout gestation. Essential role for regulation of thyroid hormone inactivation during embryological development.

Research Articles on DIO3

Similar Products

Product Notes

The DIO3 dio3 (Catalog #AAA1158999) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 68-304 aa (The original sequence contains one ‘U’ at the 170 site that has already been mutated to "S" in the recombinant MBS115899 protein, please refer to the sequence image and legend for details.). The amino acid sequence is listed below: RKHFLGRRRR GQPEPEVELN SEGEEVPPDD PPICVSDDNR LCTLASLKAV WHGQKLDFFK QAHEGGPAPN SEVVLPDGFQ SQHILDYAQG NRPLVLNFGS CTSPPFMARM SAFQRLVTKY QRDVDFLIIY IEEAHPSDGW VTTDSPYIIP QHRSLEDRVS AARVLQQGAP GCALVLDTMA NSSSSAYGAY FERLYVIQSG TIMYQGGRGP DGYQVSELRT WLERYDEQLH GARPRRV . It is sometimes possible for the material contained within the vial of "Type III iodothyronine deiodinase (DIO3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.