Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Probable ATP-dependent RNA helicase DDX28 (Ddx28) Recombinant Protein | Ddx28 recombinant protein

Recombinant Mouse Probable ATP-dependent RNA helicase DDX28 (Ddx28)

Gene Names
Ddx28; Mddx28; AI449652; 2410004K13Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable ATP-dependent RNA helicase DDX28 (Ddx28); Recombinant Mouse Probable ATP-dependent RNA helicase DDX28 (Ddx28); Ddx28 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-540, Full length protein
Sequence
MALAGPSRLLALAVRLLLEPRRNLVVRGSDQSLPVVRVPRALQRRQEQRQSGRGSLQRPVLVRPGPLLVSARRPELNQPARLTLGRWERAPLASRGWKHRRSRQDHFSIERVQQEAPALRNLSSRGSFVDLGLEPRVLLALQEAVPEVVQPTSVQSKTIPPLLRGRHLLCAAETGSGKTLSYLLPLFQRLLRGSDLDSRSFTAPRGLVLVPSRELAEQVQAVAQSLGGYLGLQVIELGGGLGMSRLKLQLYRRPAADVLVATPGALWKALKSQLISLQHLNFIVLDEVDTLLDESFLELVDYILEKSPIAESPAELEDPFNPKAQLVLVGATFPEGLNQLLSKVTSPDSLTTITSSKLHCLMPHVRQTFMRLKGADKVTELVQILKQQDKASKTEPSGTVLVFCNSASTVNWLGYILDDHKIQHLRLQGQMPASMRAGIFQSFQKGSQNILVCTDIASRGLDSVHVEVVINYDFPPTLQDYIHRAGRVGRVGSEVPGSVISFVTHPWDVSLVQKIELAARRRRSLPGLASSVGDPLPQKA
Sequence Length
540
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ddx28 recombinant protein
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene is intronless. It encodes an RNA-dependent ATPase. The encoded protein is localized in the mitochondria and the nucleus, and can be transported between the mitochondria and the nucleus.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,515 Da
NCBI Official Full Name
probable ATP-dependent RNA helicase DDX28
NCBI Official Synonym Full Names
DEAD (Asp-Glu-Ala-Asp) box polypeptide 28
NCBI Official Symbol
Ddx28
NCBI Official Synonym Symbols
Mddx28; AI449652; 2410004K13Rik
NCBI Protein Information
probable ATP-dependent RNA helicase DDX28
UniProt Protein Name
Probable ATP-dependent RNA helicase DDX28
UniProt Gene Name
Ddx28

Uniprot Description

Plays an essential role in facilitating the proper assembly of the mitochondrial large ribosomal subunit and its helicase activity is essential for this function. May be involved in RNA processing or transport. Has RNA and Mg2+-dependent ATPase activity ().

Similar Products

Product Notes

The Ddx28 ddx28 (Catalog #AAA1328029) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-540, Full length protein. The amino acid sequence is listed below: MALAGPSRLL ALAVRLLLEP RRNLVVRGSD QSLPVVRVPR ALQRRQEQRQ SGRGSLQRPV LVRPGPLLVS ARRPELNQPA RLTLGRWERA PLASRGWKHR RSRQDHFSIE RVQQEAPALR NLSSRGSFVD LGLEPRVLLA LQEAVPEVVQ PTSVQSKTIP PLLRGRHLLC AAETGSGKTL SYLLPLFQRL LRGSDLDSRS FTAPRGLVLV PSRELAEQVQ AVAQSLGGYL GLQVIELGGG LGMSRLKLQL YRRPAADVLV ATPGALWKAL KSQLISLQHL NFIVLDEVDT LLDESFLELV DYILEKSPIA ESPAELEDPF NPKAQLVLVG ATFPEGLNQL LSKVTSPDSL TTITSSKLHC LMPHVRQTFM RLKGADKVTE LVQILKQQDK ASKTEPSGTV LVFCNSASTV NWLGYILDDH KIQHLRLQGQ MPASMRAGIF QSFQKGSQNI LVCTDIASRG LDSVHVEVVI NYDFPPTLQD YIHRAGRVGR VGSEVPGSVI SFVTHPWDVS LVQKIELAAR RRRSLPGLAS SVGDPLPQKA. It is sometimes possible for the material contained within the vial of "Probable ATP-dependent RNA helicase DDX28 (Ddx28), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.