DAN domain family member 5 Recombinant Protein | DAND5 recombinant protein

Recombinant Human DAN domain family member 5

Cat. Num. AAA1332124

• Gene Names: DAND5; SP1; CER2; COCO; CRL2; CERL2; DANTE; GREM3; CKTSF1B3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: DAN domain family member 5; Recombinant Human DAN domain family member 5; Cerberus-like protein 2; Cerl-2; Cysteine knot superfamily 1; BMP antagonist 3; Gremlin-3; DAND5 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 23-189. Full length of the mature protein.
• Sequence: RPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSWKAFLGLQKARQLGMGRLQRGQDEVAAVTLPLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA
• Sequence Length: 189

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for DAND5 recombinant protein

Ses to play a role in the correct specification of the left-right axis. May antagonize NODAL and BMP4 signaling. Cystine knot-containing proteins play important roles during development, organogenesis, tissue growth and differentiation.

References

Cysteine knot protein (SP1) .Itoh N.Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Identification and characterization of human CKTSF1B2 and CKTSF1B3 genes in silico.Katoh M., Katoh M.Oncol. Rep. 12:423-427(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 22749329
• NCBI GeneID: 199699
• NCBI Accession #: NP_689867.1
• NCBI GenBank Nucleotide #: NM_152654.2
• UniProt Accession #: Q8N907
• Molecular Weight: 34.1 kDa
• NCBI Official Full Name: DAN domain family member 5
• NCBI Official Synonym Full Names: DAN domain family member 5, BMP antagonist
• NCBI Official Symbol: DAND5
• NCBI Official Synonym Symbols: SP1; CER2; COCO; CRL2; CERL2; DANTE; GREM3; CKTSF1B3
• NCBI Protein Information: DAN domain family member 5
• UniProt Protein Name: DAN domain family member 5
• Protein Family: DAN domain family
• UniProt Gene Name: DAND5
• UniProt Synonym Gene Names: CER2; CKTSF1B3; GREM3; SP1; Cerl-2
• UniProt Entry Name: DAND5_HUMAN

NCBI Description

This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation. In mouse, this protein has been shown to bind Nodal and to inhibit the Nodal signaling pathway which patterns left/right body asymmetry. [provided by RefSeq, Jul 2008]

Uniprot Description

DAND5: Seems to play a role in the correct specification of the left-right axis. May antagonize NODAL and BMP4 signaling. Cystine knot-containing proteins play important roles during development, organogenesis, tissue growth and differentiation. Belongs to the DAN family.

Protein type: Secreted; Secreted, signal peptide; Cell development/differentiation

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: extracellular region

Molecular Function: morphogen activity

Biological Process: negative regulation of BMP signaling pathway; negative regulation of transforming growth factor beta receptor signaling pathway