Mouse anti-Human ENTPD4 Monoclonal Antibody | anti-ENTPD4 antibody

ENTPD4 (KIAA0392, LALP70, LYSAL1, Ectonucleoside Triphosphate Diphosphohydrolase 4, Lysosomal Apyrase-like Protein of 70kD, Uridine-diphosphatase, UDPase) (HRP)

Cat. Num. AAA6152345

• Gene Names: ENTPD4; LAP70; LALP70; LYSAL1; UDPase; NTPDase-4
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ENTPD4; Monoclonal Antibody; ENTPD4 (KIAA0392; LALP70; LYSAL1; Ectonucleoside Triphosphate Diphosphohydrolase 4; Lysosomal Apyrase-like Protein of 70kD; Uridine-diphosphatase; UDPase) (HRP); anti-ENTPD4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4H7
• Specificity: Recognizes human ENTPD4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 616

• Applicable Applications for anti-ENTPD4 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa371-469 from ENTPD4 (NP_004892) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LDIKDEIQQNGQTIYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPPIHFQNSEFYGFSEFYYCTEDVLRMGGDYNAAKFTKAAKDYCATKWSILR
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD))

Testing Data

(Detection limit for recombinant GST tagged ENTPD4 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-ENTPD4 antibody

Hydrolyzes preferentially nucleoside 5'-diphosphates, nucleoside 5'-triphosphates are hydrolyzed only to a minor extent. The order of activity with different substrates is UDP >> GDP = CDP = TDP, AMP, ADP, ATP and UMP are not substrates. Preferred substrates for isoform 2 are CTP, UDP, CDP, GTP and GDP, while isoform 1 utilizes UTP and TTP.

Product Categories/Family for anti-ENTPD4 antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 4758662
• NCBI GeneID: 9583
• NCBI Accession #: NP_004892
• NCBI GenBank Nucleotide #: NM_004901
• UniProt Accession #: Q9Y227
• NCBI Official Full Name: ectonucleoside triphosphate diphosphohydrolase 4 isoform a
• NCBI Official Synonym Full Names: ectonucleoside triphosphate diphosphohydrolase 4
• NCBI Official Symbol: ENTPD4
• NCBI Official Synonym Symbols: LAP70; LALP70; LYSAL1; UDPase; NTPDase-4
• NCBI Protein Information: ectonucleoside triphosphate diphosphohydrolase 4
• UniProt Protein Name: Ectonucleoside triphosphate diphosphohydrolase 4
• Protein Family: Ectonucleoside triphosphate diphosphohydrolase
• UniProt Gene Name: ENTPD4
• UniProt Synonym Gene Names: KIAA0392; LALP70; LYSAL1; NTPDase 4; UDPase
• UniProt Entry Name: ENTP4_HUMAN

NCBI Description

This gene encodes a member of the apyrase protein family. Apyrases are enzymes that catalyze the hydrolysis of nucleotide diphosphates and triphosphates in a calcium or magnesium-dependent manner. The encoded protein is an endo-apyrase and may play a role in salvaging nucleotides from lysosomes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and these isoforms may differ in divalent cation dependence and substrate specificity. [provided by RefSeq, Sep 2011]

Uniprot Description

UDPase: an ectonucleoside triphosphate diphosphohydrolase. Hydrolyzes preferentially nucleoside 5'-diphosphates; nucleoside 5'-triphosphates are hydrolyzed only to a minor extent. The order of activity with different substrates is UDP >> GDP = CDP = TDP; AMP, ADP, ATP and UMP are not substrates. Two splice variant isoforms have been described. Preferred substrates for isoform 2 are CTP, UDP, CDP, GTP and GDP, while isoform 1 utilizes UTP and TTP

Protein type: Membrane protein, integral; Hydrolase; EC 3.6.1.6; Nucleotide Metabolism - purine; Nucleotide Metabolism - pyrimidine; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 8p21.3

Cellular Component: intracellular membrane-bound organelle; integral to Golgi membrane; cytoplasmic vesicle

Molecular Function: uridine-diphosphatase activity

Biological Process: UDP catabolic process