C-X-C motif chemokine 3 Recombinant Protein | Cxcl3 recombinant protein

Recombinant Mouse C-X-C motif chemokine 3 protein

Cat. Num. AAA969765

• Gene Names: Cxcl3; Dcip1; Gm1960
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: C-X-C motif chemokine 3; Recombinant Mouse C-X-C motif chemokine 3 protein; Dendritic cell inflammatory protein 11; Cxcl3 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 32-100aa; Full Length
• Sequence: SELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS
• Sequence Length: 100

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Cxcl3 recombinant protein

Ligand for CXCR2. Has chotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.

References

IL-10-conditioned dendritic cells, decommissioned for recruitment of adaptive immunity, elicit innate inflammatory gene products in response to danger signals.Nolan K.F., Strong V., Soler D., Fairchild P.J., Cobbold S.P., Croxton R., Gonzalo J.-A., Rubio A., Wells M., Waldmann H.J. Immunol. 172:2201-2209(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 42600573
• NCBI GeneID: 330122
• NCBI Accession #: NP_976065.1
• NCBI GenBank Nucleotide #: NM_203320.3
• UniProt Accession #: Q6W5C0; Q3UNK9
• Molecular Weight: 11.6 kDa
• NCBI Official Full Name: C-X-C motif chemokine 3
• NCBI Official Synonym Full Names: chemokine (C-X-C motif) ligand 3
• NCBI Official Symbol: Cxcl3
• NCBI Official Synonym Symbols: Dcip1; Gm1960
• NCBI Protein Information: C-X-C motif chemokine 3
• UniProt Protein Name: C-X-C motif chemokine 3
• Protein Family: C-X-C motif chemokine
• UniProt Gene Name: Cxcl3
• UniProt Entry Name: CXCL3_MOUSE

NCBI Description

This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This secretory protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils. [provided by RefSeq, May 2013]

Uniprot Description

CXCL1: Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO- alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted

Cellular Component: cytosol; extracellular region; extracellular space

Molecular Function: chemokine activity; CXCR chemokine receptor binding; cytokine activity; protein binding

Biological Process: chemotaxis; elevation of cytosolic calcium ion concentration; G-protein coupled receptor protein signaling pathway; immune response; inflammatory response; neutrophil chemotaxis; regulation of cell proliferation; response to lipopolysaccharide