SDS-Page
C-type lectin domain family 4 member A (Clec4a) Recombinant Protein | Clec4a recombinant protein
Recombinant Mouse C-type lectin domain family 4 member A (Clec4a)
Gene Names
Clec4a2; DCIR; Dcir1; Clec4a; Clecsf6
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-type lectin domain family 4 member A (Clec4a); Recombinant Mouse C-type lectin domain family 4 member A (Clec4a); C-type lectin domain family 4 member A; C-type lectin superfamily member 6; Dendritic cell immunoreceptor; Clec4a recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
70-238aa; Extracellular Domain
Sequence
QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL
Sequence Length
238
Species
Mus musculus (Mouse)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-Page
SDS-Page
Related Product Information for Clec4a recombinant protein
May be involved in regulating immune reactivity. May play a role in modulating dendritic cells (DC) differentiation and/or maturation. May be involved in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation.
Product Categories/Family for Clec4a recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39.6 kDa
NCBI Official Full Name
C-type lectin domain family 4 member A isoform b
NCBI Official Synonym Full Names
C-type lectin domain family 4, member a2
NCBI Official Symbol
Clec4a2
NCBI Official Synonym Symbols
DCIR; Dcir1; Clec4a; Clecsf6
NCBI Protein Information
C-type lectin domain family 4 member A; dendritic cell immunoreceptor; C-type lectin superfamily member 6; C-type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 6
UniProt Protein Name
C-type lectin domain family 4 member A
Protein Family
UniProt Gene Name
Clec4a
UniProt Synonym Gene Names
Clec4a2; Clecsf6; Dcir
UniProt Entry Name
CLC4A_MOUSE
Uniprot Description
CLEC4A: May be involved in regulating immune reactivity. May play a role in modulating dendritic cells (DC) differentiation and/or maturation. May be involved via its ITIM motif (immunoreceptor tyrosine-based inhibitory motifs) in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral; Motility/polarity/chemotaxis
Cellular Component: membrane; integral to membrane
Molecular Function: carbohydrate binding
Biological Process: immune system process; innate immune response
Research Articles on Clec4a
Similar Products
Product Notes
The Clec4a clec4a (Catalog #AAA1282632) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 70-238aa; Extracellular Domain. The amino acid sequence is listed below: QKYSQLLEEK KAAKNIMHNE LNCTKSVSPM EDKVWSCCPK DWRLFGSHCY LVPTVSSSAS WNKSEENCSR MGAHLVVIQS QEEQDFITGI LDTHAAYFIG LWDTGHRQWQ WVDQTPYEES ITFWHNGEPS SGNEKCATII YRWKTGWGWN DISCSLKQKS VCQMKKINL. It is sometimes possible for the material contained within the vial of "C-type lectin domain family 4 member A (Clec4a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
