Gamma-synuclein Recombinant Protein | SNCG recombinant protein

Recombinant Human Gamma-synuclein

Cat. Num. AAA1047325

• Gene Names: SNCG; SR; BCSG1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Gamma-synuclein; Recombinant Human Gamma-synuclein; Breast cancer-specific gene 1 protein; Persyn; Synoretin; SR; SNCG recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-127aa; Full Length
• Sequence: MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
• Sequence Length: 127

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for SNCG recombinant protein

Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway.

Product Categories/Family for SNCG recombinant protein

Neuroscience

References

Identification of a breast cancer-specific gene, BCSG1, by direct differential cDNA sequencing.Ji H., Liu Y.E., Jia T., Wang M., Liu J., Xiao G., Joseph B.K., Rosen C., Shi Y.E.Cancer Res. 57:759-764(1997) Organization, expression and polymorphism of the human persyn gene.Ninkina N.N., Alimova-Kost M.V., Paterson J.W.E., Delaney L., Cohen B.B., Imreh S., Gnuchev N.V., Davies A.M., Buchman V.L.Hum. Mol. Genet. 7:1417-1424(1998) Identification, localization and characterization of the human gamma-synuclein gene.Lavedan C., Leroy E., Dehejia A., Buchholtz S., Dutra A., Nussbaum R.L., Polymeropoulos M.H.Hum. Genet. 103:106-112(1998) Han C., Zhang B., Peng X., Yuan J., Qiang B. Synucleins are a novel class of substrates for G protein-coupled receptor kinases.Pronin A.N., Morris A.J., Surguchov A., Benovic J.L.J. Biol. Chem. 275:26515-26522(2000) Gamma synuclein subcellular localization in neuronal and non-neuronal cells and effect on signal transduction.Surguchov A., Palazzo R.E., Surgucheva I.Cell Motil. Cytoskeleton 49:218-228(2001) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)

NCBI and Uniprot Product Information

• NCBI GI #: 209693439
• NCBI GeneID: 6623
• NCBI Accession #: NP_003078.2
• NCBI GenBank Nucleotide #: NM_003087.2
• UniProt Accession #: O76070; O15104; Q96P61
• Molecular Weight: 29.3 kDa
• NCBI Official Full Name: gamma-synuclein
• NCBI Official Synonym Full Names: synuclein gamma
• NCBI Official Symbol: SNCG
• NCBI Official Synonym Symbols: SR; BCSG1
• NCBI Protein Information: gamma-synuclein
• UniProt Protein Name: Gamma-synuclein
• Protein Family: Gamma-synuclein
• UniProt Gene Name: SNCG
• UniProt Synonym Gene Names: BCSG1; PERSYN; PRSN; SR
• UniProt Entry Name: SYUG_HUMAN

NCBI Description

This gene encodes a member of the synuclein family of proteins which are believed to be involved in the pathogenesis of neurodegenerative diseases. Mutations in this gene have also been associated with breast tumor development. [provided by RefSeq, Jan 2010]

Uniprot Description

SNCG: a member of the synuclein family of proteins which are believed to be involved in the pathogenesis of neurodegenerative diseases. May be involved in modulating axonal architecture during development and in the adult. Plays a role in neurofilament network integrity. High levels have been identified in advanced breast carcinomas.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 10q23.2-q23.3

Cellular Component: axon; cell soma; cytoplasm; microtubule organizing center; perinuclear region of cytoplasm; spindle

Molecular Function: protein binding

Biological Process: adult locomotory behavior; protein secretion; regulation of dopamine secretion; regulation of neurotransmitter secretion; synapse organization and biogenesis; synaptic transmission