SDS-Page
Cementoblastoma-derived protein 1 (CEMP1) Recombinant Protein | CEMP1 recombinant protein
Recombinant Human Cementoblastoma-derived protein 1 (CEMP1)
Gene Names
CEMP1; CP23; CP-23
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cementoblastoma-derived protein 1 (CEMP1); Recombinant Human Cementoblastoma-derived protein 1 (CEMP1); CEMP1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-247aa, full length protein
Sequence
MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPHTSQEVRIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTARVCHMGVCQGQGDTEDGRMTLMG
Sequence Length
247
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-Page
SDS-Page
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28 kDa
NCBI Official Full Name
cementoblastoma-derived protein 1
NCBI Official Synonym Full Names
cementum protein 1
NCBI Official Symbol
CEMP1
NCBI Official Synonym Symbols
CP23; CP-23
NCBI Protein Information
cementoblastoma-derived protein 1
UniProt Protein Name
Cementoblastoma-derived protein 1
Protein Family
UniProt Gene Name
CEMP1
UniProt Synonym Gene Names
CP-23
Uniprot Description
May play a role in development of the periodontium which surrounds and supports the teeth by promoting the differentiation of multi-potent cells from the periodontal ligament into cementoblasts to form the cementum (PubMed:21929512, PubMed:17509525, PubMed:21465469). Binds hydroxyapatite and may promote the biomineralization of the cementum (PubMed:19393626). Also promotes cell proliferation (PubMed:17509525, PubMed:21929512, PubMed:26011628).
Research Articles on CEMP1
Similar Products
Product Notes
The CEMP1 cemp1 (Catalog #AAA1355581) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-247aa, full length protein. The amino acid sequence is listed below: MGTSSTDSQQ AGHRRCSTSN TSAENLTCLS LPGSPGKTAP LPGPAQAGAG QPLPKGCAAV KAEVGIPAPH TSQEVRIHIR RLLSWAAPGA CGLRSTPCAL PQALPQARPC PGRWFFPGCS LPTGGAQTIL SLWTWRHFLN WALQQREENS GRARRVPPVP RTAPVSKGEG SHPPQNSNGE KVKTITPDVG LHQSLTSDPT VAVLRAKRAP EAHPPRSCSG SLTARVCHMG VCQGQGDTED GRMTLMG. It is sometimes possible for the material contained within the vial of "Cementoblastoma-derived protein 1 (CEMP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
