Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Cysteine dioxygenase type 1 (CDO1) Recombinant Protein | CDO1 recombinant protein

Recombinant Human Cysteine dioxygenase type 1 (CDO1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cysteine dioxygenase type 1 (CDO1); Recombinant Human Cysteine dioxygenase type 1 (CDO1); Cysteine dioxygenase type 1; EC=1.13.11.20; Cysteine dioxygenase type I; CDO; CDO-I; CDO1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-200aa; Full Length
Sequence
MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN
Sequence Length
200
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for CDO1 recombinant protein
Initiates several important metabolic pathways related to pyruvate and several sulfurate compounds including sulfate, hypotaurine and taurine. Critical regulator of cellular cysteine concentrations. Has an important role in maintaining the hepatic concentation of intracellular free cysteine within a proper narrow range.
Product Categories/Family for CDO1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50 kDa
NCBI Official Full Name
cysteine dioxygenase type 1
NCBI Official Synonym Full Names
cysteine dioxygenase type 1
NCBI Official Symbol
CDO1
NCBI Protein Information
cysteine dioxygenase type 1; CDO; CDO-I; cysteine dioxygenase, type I
UniProt Protein Name
Cysteine dioxygenase type 1
Protein Family
UniProt Gene Name
CDO1
UniProt Synonym Gene Names
CDO; CDO-I
UniProt Entry Name
CDO1_HUMAN

Uniprot Description

CDO1: Initiates several important metabolic pathways related to pyruvate and several sulfurate compounds including sulfate, hypotaurine and taurine. Critical regulator of cellular cysteine concentrations. Has an important role in maintaining the hepatic concentation of intracellular free cysteine within a proper narrow range. Belongs to the cysteine dioxygenase family.

Protein type: EC 1.13.11.20; Other Amino Acids Metabolism - taurine and hypotaurine; Oxidoreductase; Amino Acid Metabolism - cysteine and methionine

Chromosomal Location of Human Ortholog: 5q23.2

Cellular Component: cytosol

Molecular Function: cysteine dioxygenase activity; ferrous iron binding

Biological Process: lactation; cysteine metabolic process; response to cAMP; response to ethanol; sulfur amino acid biosynthetic process; response to glucagon stimulus; sulfur amino acid metabolic process; sulfur amino acid catabolic process; response to glucocorticoid stimulus; taurine biosynthetic process; response to amino acid stimulus; inflammatory response; L-cysteine catabolic process

Research Articles on CDO1

Similar Products

Product Notes

The CDO1 cdo1 (Catalog #AAA1407887) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-200aa; Full Length. The amino acid sequence is listed below: MEQTEVLKPR TLADLIRILH QLFAGDEVNV EEVQAIMEAY ESDPTEWAMY AKFDQYRYTR NLVDQGNGKF NLMILCWGEG HGSSIHDHTN SHCFLKMLQG NLKETLFAWP DKKSNEMVKK SERVLRENQC AYINDSIGLH RVENISHTEP AVSLHLYSPP FDTCHAFDQR TGHKNKVTMT FHSKFGIRTP NATSGSLENN. It is sometimes possible for the material contained within the vial of "Cysteine dioxygenase type 1 (CDO1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.