Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CDO1Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CDO1 Polyclonal Antibody | anti-CDO1 antibody

CDO1 Antibody - middle region

Gene Names
CDO1; CDO-I
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CDO1; Polyclonal Antibody; CDO1 Antibody - middle region; anti-CDO1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGE
Sequence Length
200
Applicable Applications for anti-CDO1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CDO1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CDO1Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CDO1Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CDO1 antibody
Initiates several important metabolic pathways related to pyruvate and several sulfurate compounds including sulfate, hypotaurine and taurine. Critical regulator of cellular cysteine concentrations. Has an important role in maintaining the hepatic concentation of intracellular free cysteine within a proper narrow range.
Product Categories/Family for anti-CDO1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22 kDa
NCBI Official Full Name
cysteine dioxygenase type 1 isoform 2
NCBI Official Synonym Full Names
cysteine dioxygenase type 1
NCBI Official Symbol
CDO1
NCBI Official Synonym Symbols
CDO-I
NCBI Protein Information
cysteine dioxygenase type 1
UniProt Protein Name
Cysteine dioxygenase type 1
Protein Family
UniProt Gene Name
CDO1
UniProt Synonym Gene Names
CDO; CDO-I
UniProt Entry Name
CDO1_HUMAN

Uniprot Description

CDO1: Initiates several important metabolic pathways related to pyruvate and several sulfurate compounds including sulfate, hypotaurine and taurine. Critical regulator of cellular cysteine concentrations. Has an important role in maintaining the hepatic concentation of intracellular free cysteine within a proper narrow range. Belongs to the cysteine dioxygenase family.

Protein type: Other Amino Acids Metabolism - taurine and hypotaurine; Oxidoreductase; EC 1.13.11.20; Amino Acid Metabolism - cysteine and methionine

Chromosomal Location of Human Ortholog: 5q23.2

Cellular Component: cytosol

Molecular Function: cysteine dioxygenase activity; ferrous iron binding

Biological Process: lactation; cysteine metabolic process; sulfur amino acid biosynthetic process; response to ethanol; response to cAMP; response to glucagon stimulus; sulfur amino acid metabolic process; sulfur amino acid catabolic process; response to glucocorticoid stimulus; taurine biosynthetic process; inflammatory response; response to amino acid stimulus; L-cysteine catabolic process

Research Articles on CDO1

Similar Products

Product Notes

The CDO1 cdo1 (Catalog #AAA3222550) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDO1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDO1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDO1 cdo1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VEEVQAIMEA YESDPTEWAM YAKFDQYRYT RNLVDQGNGK FNLMILCWGE. It is sometimes possible for the material contained within the vial of "CDO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.