Rabbit anti-Human Uridine 5'-monophosphate Synthase Polyclonal Antibody | anti-UMPS antibody

Uridine 5'-monophosphate Synthase (UMP Synthase, UMPS, OK/SW-cl.21) (HRP)

Cat. Num. AAA6398044

• Gene Names: UMPS; OPRT
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Uridine 5'-monophosphate Synthase; Polyclonal Antibody; Uridine 5'-monophosphate Synthase (UMP Synthase; UMPS; OK/SW-cl.21) (HRP); Orotate Phosphoribosyltransferase; OPRT; OPRTase; EC=2.4.2.10; Orotidine 5'-phosphate Decarboxylase; ODC; OMPdecase; EC=4.1.1.23; anti-UMPS antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human UMPS.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-UMPS antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human UMPS, aa1-480 (NP_000364.1).
• Immunogen Sequence: MAVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(UMPS rabbit polyclonal antibody. Western Blot analysis of UMPS expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of UMPS expression in transfected 293T cell line by UMPS polyclonal antibody. Lane 1: UMPS transfected lysate (52.2kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-UMPS antibody

Antibodies; Enzymes; Synthase

NCBI and Uniprot Product Information

• NCBI GI #: 4507835
• NCBI GeneID: 7372
• NCBI Accession #: NP_000364.1
• NCBI GenBank Nucleotide #: NM_000373.1
• UniProt Accession #: P11172; O00758; O00759; O00760; Q16862; Q9H3Q2; Q9UG49; B5LY68; B5LY72
• Molecular Weight: 22,922 Da
• NCBI Official Full Name: uridine 5'-monophosphate synthase
• NCBI Official Synonym Full Names: uridine monophosphate synthetase
• NCBI Official Symbol: UMPS
• NCBI Official Synonym Symbols: OPRT
• NCBI Protein Information: uridine 5'-monophosphate synthase; OMPdecase; OPRTase; UMP synthase; orotate phosphoribosyltransferase; orotidine 5'-phosphate decarboxylase
• UniProt Protein Name: Uridine 5'-monophosphate synthase
• Protein Family: Uridine 5'-monophosphate synthase
• UniProt Gene Name: UMPS
• UniProt Synonym Gene Names: UMP synthase; OPRT; OPRTase; ODC
• UniProt Entry Name: UMPS_HUMAN

NCBI Description

This gene encodes a uridine 5'-monophosphate synthase. The encoded protein is a bifunctional enzyme that catalyzes the final two steps of the de novo pyrimidine biosynthetic pathway. The first reaction is carried out by the N-terminal enzyme orotate phosphoribosyltransferase which converts orotic acid to orotidine-5'-monophosphate. The terminal reaction is carried out by the C-terminal enzyme OMP decarboxylase which converts orotidine-5'-monophosphate to uridine monophosphate. Defects in this gene are the cause of hereditary orotic aciduria. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]

Uniprot Description

UMPS: Defects in UMPS are the cause of orotic aciduria type 1 (ORAC1). A disorder of pyrimidine metabolism resulting in megaloblastic anemia and orotic acid crystalluria that is frequently associated with some degree of physical and mental retardation. A minority of cases have additional features, particularly congenital malformations and immune deficiencies. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 4.1.1.23; Transferase; Xenobiotic Metabolism - drug metabolism - other enzymes; Nucleotide Metabolism - pyrimidine; EC 2.4.2.10; Lyase

Chromosomal Location of Human Ortholog: 3q13

Cellular Component: cytoplasm; cytosol; nucleus

Molecular Function: orotate phosphoribosyltransferase activity; orotidine-5'-phosphate decarboxylase activity

Biological Process: lactation; 'de novo' pyrimidine base biosynthetic process; pyrimidine base metabolic process; nucleobase, nucleoside and nucleotide metabolic process; UMP biosynthetic process; pyrimidine nucleoside biosynthetic process; female pregnancy

Disease: Orotic Aciduria