CD79B recombinant protein

CD79B, human recombinant

Cat. Num. AAA847118

• Gene Names: CD79B; B29; IGB; AGM6
• Purity: >=90% by SDS-PAGE
• Synonyms: CD79B; human recombinant; CD79b molecule; immunoglobulin-associated beta; AGM6; B29; IGB; CD79B recombinant protein

• Host: E Coli
• Purity/Purification: >=90% by SDS-PAGE
• Form/Format: Liquid. 1mg/ml in 20mM Tris-HCl buffer (pH8.0) containing 2 M Urea and 10% glycerol.
• Concentration: 1mg/ml (varies by lot)
• Sequence: MGSSHHHHHHSSGLVPRGSHMGSMARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

• Gene Source: Human
• Endotoxin: <1.0 EU per 1 microgram of protein
• Dry Ice Shipment: Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
• Preparation and Storage: Store at -80 degree C.; Centrifuge the vial prior to opening.; Shipping: Dry Ice; Shelf life: ~12 months

SDS-Page

Related Product Information for CD79B recombinant protein

CD79B, also known as Igb and B29, is a 36 kDa transmembrane glycoprotein in the immunoglobulin superfamily. Heterodimers of CD79A and CD79B associate with a membrane bound immunoglobulin on the B cell surface to form the B cell antigen receptor complex (BCR). CD79A and CD79B are required for BCR-mediated signaling and consequently for the development and activation of B lineage cells. Recombinant human CD79B protein, fused to His-tag at N-terminus, was expressed in E Coli. Required for BCR-mediated signaling

Product Categories/Family for CD79B recombinant protein

Cytokines; Growth Factors & Hormones; CDs; Cytokines; Cytokines & Growth Factors (A-Z); Proteins; Enzymes; Proteins & Enzymes (A-Z)

NCBI and Uniprot Product Information

• NCBI GI #: 728994
• NCBI GeneID: 974
• UniProt Accession #: P40259; Q53FS2; Q9BU06
• Molecular Weight: 229
• NCBI Official Full Name: B-cell antigen receptor complex-associated protein beta chain
• NCBI Official Synonym Full Names: CD79b molecule, immunoglobulin-associated beta
• NCBI Official Symbol: CD79B
• NCBI Official Synonym Symbols: B29; IGB; AGM6
• NCBI Protein Information: B-cell antigen receptor complex-associated protein beta chain; Ig-beta; B-cell-specific glycoprotein B29; immunoglobulin-associated B29 protein; CD79b antigen (immunoglobulin-associated beta)
• UniProt Protein Name: B-cell antigen receptor complex-associated protein beta chain
• Protein Family: B-cell antigen receptor complex-associated protein
• UniProt Gene Name: CD79B
• UniProt Synonym Gene Names: B29; IGB
• UniProt Entry Name: CD79B_HUMAN

NCBI Description

The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

Ig-beta: Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation. Defects in CD79B are the cause of agammaglobulinemia type 6 (AGM6). It is a primary immunodeficiency characterized by profoundly low or absent serum antibodies and low or absent circulating B-cells due to an early block of B-cell development. Affected individuals develop severe infections in the first years of life. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17q23

Cellular Component: nucleoplasm; Golgi apparatus; integral to plasma membrane; cytoplasm; plasma membrane; B cell receptor complex; external side of plasma membrane

Molecular Function: transmembrane receptor activity

Biological Process: B cell receptor signaling pathway; immune response; signal transduction

Disease: Agammaglobulinemia 6, Autosomal Recessive