Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CD79B expression in transfected 293T cell line by CD79B polyclonal antibody. Lane 1: CD79B transfected lysate (26kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CD79B Polyclonal Antibody | anti-CD79B antibody

CD79B (B Cell Antigen Receptor Complex-associated Protein beta Chain, B Cell-specific Glycoprotein B29, Ig-beta, Immunoglobulin-associated B29 Protein, B29, IGB) APC

Gene Names
CD79B; B29; IGB; AGM6
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD79B; Polyclonal Antibody; CD79B (B Cell Antigen Receptor Complex-associated Protein beta Chain; B Cell-specific Glycoprotein B29; Ig-beta; Immunoglobulin-associated B29 Protein; B29; IGB) APC; anti-CD79B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CD79B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CD79B antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CD79B, aa1-229 (NP_000617.1).
Immunogen Sequence
MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CD79B expression in transfected 293T cell line by CD79B polyclonal antibody. Lane 1: CD79B transfected lysate (26kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CD79B expression in transfected 293T cell line by CD79B polyclonal antibody. Lane 1: CD79B transfected lysate (26kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CD79B antibody
The CD79 molecule, comprising two polypeptide chains, mb-1 (CD79a) and B29 (CD79b), is physically associated in the B-cell membrane with immunoglobulins to constitute the B cell antigen receptor (BCR). The CD79a/b heterodimer interacts with at least one tyrosine kinase (Lyn). Induction of tyrosine kinase activity after antigen binding causes phosphorylation of the CD79a/b dimer, and also of other molecules, thereby initiating intracellular signaling. Almost all acute lymphoblastic leukemias of precursor B cell type are positive when tested with CD79a antibodies.
Product Categories/Family for anti-CD79B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
974
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,119 Da
NCBI Official Full Name
B-cell antigen receptor complex-associated protein beta chain isoform 1
NCBI Official Synonym Full Names
CD79b molecule, immunoglobulin-associated beta
NCBI Official Symbol
CD79B
NCBI Official Synonym Symbols
B29; IGB; AGM6
NCBI Protein Information
B-cell antigen receptor complex-associated protein beta chain; B-cell-specific glycoprotein B29; CD79b antigen (immunoglobulin-associated beta); Ig-beta; immunoglobulin-associated B29 protein
UniProt Protein Name
B-cell antigen receptor complex-associated protein beta chain
UniProt Gene Name
CD79B
UniProt Synonym Gene Names
B29; IGB
UniProt Entry Name
CD79B_HUMAN

NCBI Description

The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

Ig-beta: Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation. Defects in CD79B are the cause of agammaglobulinemia type 6 (AGM6). It is a primary immunodeficiency characterized by profoundly low or absent serum antibodies and low or absent circulating B-cells due to an early block of B-cell development. Affected individuals develop severe infections in the first years of life. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17q23

Cellular Component: nucleoplasm; Golgi apparatus; integral to plasma membrane; cytoplasm; plasma membrane; B cell receptor complex; external side of plasma membrane

Molecular Function: transmembrane receptor activity

Biological Process: B cell receptor signaling pathway; immune response; signal transduction

Disease: Agammaglobulinemia 6, Autosomal Recessive

Research Articles on CD79B

Similar Products

Product Notes

The CD79B cd79b (Catalog #AAA6373280) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD79B (B Cell Antigen Receptor Complex-associated Protein beta Chain, B Cell-specific Glycoprotein B29, Ig-beta, Immunoglobulin-associated B29 Protein, B29, IGB) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD79B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD79B cd79b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD79B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.