Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data ()

CD79B recombinant protein

CD79B Recombinant Protein

Gene Names
CD79B; B29; IGB; AGM6
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Synonyms
CD79B; CD79B Recombinant Protein; CD79B recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Form/Format
PBS, 4M Urea, PH7.4
Concentration
>=0.5mg/ml (varies by lot)
Sequence
ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD
Tag
His-tag in C-terminal
Expression Vector
pet-22b(+)
BP
405
Restriction Site
NdeI-XhoI
Preparation and Storage
Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Testing Data ()
Related Product Information for CD79B recombinant protein
Background: The B cell antigen receptor (BCR) is composed of membrane immunoglobulin molecules non-covalently associated with the heterodimeric signaling component, CD79A and CD79B (also known as Igalpha and Igbeta, respectively). The presence of this receptor complex is essential for B cell development and function. Following antigen binding, CD79A/CD79B heterodimers are phosphorylated and initiate intracellular signaling through Src family kinases, Lyn, Blk, and Fyn, as well as Syk and Btk tyrosine kinases. The complexity of BCR signaling results in a variety of distinct cellular functions, such as proliferation, tolerance, apoptosis, and differentiation. BCR-antigen ligation also leads to internalization of the complex, trafficking to late endosomes, and antigen presentation in major histocompatibility molecules on the B cell surface. CD79B enhances the phosphorylation of CD79A. Alternatively spliced transcript variants encoding different isoforms of CD79B have been identified. CD79B is widely expressed on B cell malignancies and may serve as a target for therapeutic intervention.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
974
UniProt Accession #
Molecular Weight
229
NCBI Official Full Name
B-cell antigen receptor complex-associated protein beta chain
NCBI Official Synonym Full Names
CD79b molecule, immunoglobulin-associated beta
NCBI Official Symbol
CD79B
NCBI Official Synonym Symbols
B29; IGB; AGM6
NCBI Protein Information
B-cell antigen receptor complex-associated protein beta chain; Ig-beta; B-cell-specific glycoprotein B29; immunoglobulin-associated B29 protein; CD79b antigen (immunoglobulin-associated beta)
UniProt Protein Name
B-cell antigen receptor complex-associated protein beta chain
UniProt Gene Name
CD79B
UniProt Synonym Gene Names
B29; IGB
UniProt Entry Name
CD79B_HUMAN

NCBI Description

The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

Ig-beta: Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation. Defects in CD79B are the cause of agammaglobulinemia type 6 (AGM6). It is a primary immunodeficiency characterized by profoundly low or absent serum antibodies and low or absent circulating B-cells due to an early block of B-cell development. Affected individuals develop severe infections in the first years of life. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17q23

Cellular Component: nucleoplasm; Golgi apparatus; integral to plasma membrane; cytoplasm; plasma membrane; B cell receptor complex; external side of plasma membrane

Molecular Function: transmembrane receptor activity

Biological Process: B cell receptor signaling pathway; immune response; signal transduction

Disease: Agammaglobulinemia 6, Autosomal Recessive

Research Articles on CD79B

Similar Products

Product Notes

The CD79B cd79b (Catalog #AAA3003705) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: ARSEDRYRNP KGSACSRIWQ SPRFIARKRG FTVKMHCYMN SASGNVSWLW KQEMDENPQQ LKLEKGRMEE SQNESLATLT IQGIRFEDNG IYFCQQKCNN TSEVYQGCGT ELRVMGFSTL AQLKQRNTLK D. It is sometimes possible for the material contained within the vial of "CD79B, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.