Western Blot (WB)
(Host: RabbitTarget Name: MRVI1Sample Tissue: Human Thymus TumorAntibody Dilution: 1ug/ml)
Rabbit MRVI1 Polyclonal Antibody | anti-MRVI1 antibody
MRVI1 Antibody - N-terminal region
Gene Names
MRVI1; IRAG; JAW1L
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MRVI1; Polyclonal Antibody; MRVI1 Antibody - N-terminal region; anti-MRVI1 antibody
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range : 100 ul at 0.5-1mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: LVNDQLPDISISEEDKKKNLALLEEAKLVSERFLTRRGRKSRSSPGDSPS
Sequence Length
803
Applicable Applications for anti-MRVI1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MRVI1
Protein Size (# AA)
803 amino acids
Blocking Peptide
For anti-MRVI1 (MBS3209875) antibody is catalog (MBS3234830)
Tissue Tool
Find tissues and cell lines supported by DNA array analysis to express MRVI1.
RNA Seq
Find tissues and cell lines supported by RNA-seq analysis to express MRVI1.
Predicted Species Reactivity
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: MRVI1Sample Tissue: Human Thymus TumorAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: MRVI1Sample Tissue: Human Thymus TumorAntibody Dilution: 1ug/ml)
Related Product Information for anti-MRVI1 antibody
Description: This gene is similar to a putative mouse tumor suppressor gene (Mrvi1) that is frequently disrupted by mouse AIDS-related virus (MRV). The encoded protein, which is found in the membrane of the endoplasmic reticulum, is similar to Jaw1, a lymphoid-restricted protein whose expression is down-regulated during lymphoid differentiation. This protein is a substrate of cGMP-dependent kinase-1 (PKG1) that can function as a regulator of IP3-induced calcium release. Studies in mouse suggest that MRV integration at Mrvi1 induces myeloid leukemia by altering the expression of a gene important for myeloid cell growth and/or differentiation, and thus this gene may function as a myeloid leukemia tumor suppressor gene. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene, and alternative translation start sites, including a non-AUG (CUG) start site, are used.
Product Categories/Family for anti-MRVI1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88kDa
NCBI Official Full Name
protein MRVI1 isoform a
NCBI Official Synonym Full Names
murine retrovirus integration site 1 homolog
NCBI Official Symbol
MRVI1
NCBI Official Synonym Symbols
IRAG; JAW1L
NCBI Protein Information
protein MRVI1
UniProt Protein Name
Protein MRVI1
Protein Family
UniProt Gene Name
MRVI1
UniProt Synonym Gene Names
IRAG; JAW1L
UniProt Entry Name
MRVI1_HUMAN
NCBI Description
This gene is similar to a putative mouse tumor suppressor gene (Mrvi1) that is frequently disrupted by mouse AIDS-related virus (MRV). The encoded protein, which is found in the membrane of the endoplasmic reticulum, is similar to Jaw1, a lymphoid-restricted protein whose expression is down-regulated during lymphoid differentiation. This protein is a substrate of cGMP-dependent kinase-1 (PKG1) that can function as a regulator of IP3-induced calcium release. Studies in mouse suggest that MRV integration at Mrvi1 induces myeloid leukemia by altering the expression of a gene important for myeloid cell growth and/or differentiation, and thus this gene may function as a myeloid leukemia tumor suppressor gene. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene, and alternative translation start sites, including a non-AUG (CUG) start site, are used. [provided by RefSeq, May 2011]
Research Articles on MRVI1
Similar Products
Product Notes
The MRVI1 mrvi1 (Catalog #AAA3209875) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MRVI1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MRVI1 mrvi1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LVNDQLPDIS ISEEDKKKNL ALLEEAKLVS ERFLTRRGRK SRSSPGDSPS. It is sometimes possible for the material contained within the vial of "MRVI1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
