CD72 recombinant protein

CD72 Recombinant Protein

Cat. Num. AAA3003699

• Gene Names: CD72; LYB2; CD72b
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD72; CD72 Recombinant Protein; CD72 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: RYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 741
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD72 recombinant protein

Background: CD5 has been identified as a transmembrane glycoprotein that is expressed on 70% of normal peripheral blood lymphocytes and on virtually all T lymphocytes in thymus and peripheral blood. Activation of T cells through the T cell receptor (TCR) results in tyrosine phosphorylation of CD5, and the absence of CD5 renders T cells hyper-responsive to TCR-mediated activation. CD5 associates with the TCR/CD3 zeta chain, and with the Src family kinase, Lck p56. The C-type lectin superfamily member CD72 is a cell surface negative regulator of B cell activation from the pro-B through the mature B cell stage. CD72 serves as a receptor for CD5. The ability of lymphocytes to respond to antigenic or mitogenic stimulation utilizes both positive and negative regulatory proteins that influence the threshold for responsiveness. The human CD72 gene maps to chromosome 9p13.3 and encodes a transmembrane glycoprotein that contains an immunoreceptor tyrosine-based inhibition motif (ITIM). Upon tyrosine phosphorylation, the CD72 ITIM recruits SH2-containing phosphatases such as SHP-1, resulting in downregulation of cell activation. CD72-/- mice contain hyperproliferative B cells.

NCBI and Uniprot Product Information

• NCBI GI #: 4502683
• NCBI GeneID: 971
• NCBI Accession #: NP_001773.1
• NCBI GenBank Nucleotide #: NP_001773.1
• UniProt Accession #: P21854
• NCBI Official Full Name: B-cell differentiation antigen CD72
• NCBI Official Synonym Full Names: CD72 molecule
• NCBI Official Symbol: CD72
• NCBI Official Synonym Symbols: LYB2; CD72b
• NCBI Protein Information: B-cell differentiation antigen CD72
• UniProt Protein Name: B-cell differentiation antigen CD72
• Protein Family: B-cell differentiation antigen
• UniProt Gene Name: CD72
• UniProt Entry Name: CD72_HUMAN

Uniprot Description

CD72: Plays a role in B-cell proliferation and differentiation.

Protein type: Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 9p13.3

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: protein binding; transmembrane receptor activity; carbohydrate binding; receptor binding

Biological Process: axon guidance; signal transduction; cell adhesion