CD8A recombinant protein

CD8A Recombinant Protein

Cat. Num. AAA3003725

• Gene Names: CD8A; CD8; MAL; p32; Leu2
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD8A; CD8A Recombinant Protein; CD8A recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 495
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD8A recombinant protein

Background: Cluster of Differentiation 8 (CD8) is a disulphide-linked heterodimer consisting of the unrelated alpha and beta subunits. Each subunit is a glycoprotein composed of a single extracellular Ig-like domain, a polypeptide linker, a transmembrane part and a short cytoplasmic tail. On T cells, CD8 is the coreceptor for the T cell receptor (TCR), and these two distinct structures recognize the Antigen-Major Histocompatibility Complex (MHC). Specifically, the Ig-like domain of CD8alpha interacts with the alpha3-domain of the MHC class I molecule. CD8 ensures specificity of the TCR-antigen interaction, prolongs the contact between the T cell and the antigen presenting cell, and the alpha chain recruits the tyrosine kinase Lck, which is essential for T cell activation.

NCBI and Uniprot Product Information

• NCBI GI #: 225007536
• NCBI GeneID: 925
• NCBI Accession #: NP_001139345.1
• NCBI GenBank Nucleotide #: NM_001145873.1
• UniProt Accession #: P01732; Q13970; Q4ZG17; D6W5M8
• Molecular Weight: 32kDa
• NCBI Official Full Name: T-cell surface glycoprotein CD8 alpha chain isoform 1
• NCBI Official Synonym Full Names: CD8a molecule
• NCBI Official Symbol: CD8A
• NCBI Official Synonym Symbols: CD8; MAL; p32; Leu2
• NCBI Protein Information: T-cell surface glycoprotein CD8 alpha chain; T8 T-cell antigen; T cell co-receptor; OKT8 T-cell antigen; T-cell antigen Leu2; Leu2 T-lymphocyte antigen; CD8 antigen, alpha polypeptide (p32); T-lymphocyte differentiation antigen T8/Leu-2
• UniProt Protein Name: T-cell surface glycoprotein CD8 alpha chain
• Protein Family: T-cell surface glycoprotein
• UniProt Gene Name: CD8A
• UniProt Synonym Gene Names: MAL
• UniProt Entry Name: CD8A_HUMAN