CD5 recombinant protein

CD5 Recombinant Protein

Cat. Num. AAA3003662

• Gene Names: CD5; T1; LEU1
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD5; CD5 Recombinant Protein; CD5 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNP

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 1056
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD5 recombinant protein

Background: CD5 is a type-I transmembrane protein belonging to the scavenger receptor cysteine-rich (SRCR) family, characterized by the presence of at least one SRCR domain of 90-110 amino acids. CD5 is expressed by all mature T cells, the B-1a subset of mature B cells, and some leukemic B cells. Its expression is increased in regulatory T and B cells (Tregs/Bregs). Anergic T and B cells also have elevated CD5 expression. Elevated levels of CD5 are also found in many autoimmune disorders. CD5 is associated with the T cell receptor (TCR) and negatively modulates T cell activation and differentiation. CD5 expression on the tumor infiltrating T lymphocytes is inversely correlated with their antitumor activity. Recently it was reported that CD5 directly binds to IL6 and can mediate downstream signaling. CD5+ B cells promote tumor growth in animal models. Reagents targeting CD5 have been actively pursued as therapeutic interventions for cancer and other conditions.

NCBI and Uniprot Product Information

• NCBI GI #: 166197668
• NCBI GeneID: 921
• NCBI Accession #: NP_055022.2
• NCBI GenBank Nucleotide #: NM_014207.3
• UniProt Accession #: P06127; A0N0P4; A8K9I3
• Molecular Weight: 54,578 Da
• NCBI Official Full Name: T-cell surface glycoprotein CD5
• NCBI Official Synonym Full Names: CD5 molecule
• NCBI Official Symbol: CD5
• NCBI Official Synonym Symbols: T1; LEU1
• NCBI Protein Information: T-cell surface glycoprotein CD5; CD5 antigen (p56-62); lymphocyte antigen T1/Leu-1
• UniProt Protein Name: T-cell surface glycoprotein CD5
• Protein Family: CD5 antigen
• UniProt Gene Name: CD5
• UniProt Synonym Gene Names: LEU1
• UniProt Entry Name: CD5_HUMAN

Uniprot Description

CD5: a surface glycoprotein expressed on T cells and B-1 B cells. Rapidly recruited to the immunological synapse, lowering the response of the T cell antigen receptor. CD5 interacts with CD72/LYB-2. Promotes B-cell survival through stimulation of autocrine IL-10 production. Contains 3 SRCR domains.

Protein type: Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: integral to plasma membrane; plasma membrane; external side of plasma membrane

Molecular Function: protein binding; transmembrane receptor activity; receptor activity; scavenger receptor activity

Biological Process: receptor-mediated endocytosis; cell proliferation; T cell costimulation; cell recognition