Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Complement decay-accelerating factor, GPI-anchored (Cd55) Recombinant Protein | Cd55 recombinant protein

Recombinant Mouse Complement decay-accelerating factor, GPI-anchored (Cd55)

Gene Names
Cd55; Daf; Daf1; Daf-GPI; GPI-DAF
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Complement decay-accelerating factor; GPI-anchored (Cd55); Recombinant Mouse Complement decay-accelerating factor; Cd55 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
35-362, full length protein
Sequence
DCGPPPDIPNARPILGRHSKFAEQSKVAYSCNNGFKQVPDKSNIVVCLENGQWSSHETFCEKSCVAPERLSFASLKKEYLNMNFFPVGTIVEYECRPGFRKQPPLPGKATCLEDLVWSPVAQFCKKKSCPNPKDLDNGHINIPTGILFGSEINFSCNPGYRLVGVSSTFCSVTGNTVDWDDEFPVCTEIHCPEPPKINNGIMRGESDSYTYSQVVTYSCDKGFILVGNASIYCTVSKSDVGQWSSPPPRCIEKSKVPTKKPTINVPSTGTPSTPQKPTTESVPNPGDQPTPQKPSTVKVSATQHVPVTKTTVRHPIRTSTDKGEPNTG
Sequence Length
328
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Cd55 recombinant protein
This gene encodes a protein involved in the regulation of the complement cascade. The encoded glycoprotein is also known as the decay-accelerating factor (DAF); binding of DAF to complement proteins accelerates their decay, disrupting the cascade and preventing damage to host cells. Antigens present on the DAF glycoprotein constitute the Cromer blood group system (CROM). Two alternatively spliced transcripts encoding different proteins have been identified. The predominant transcript encodes a membrane-bound protein expressed on cells exposed to plasma component proteins but an alternatively spliced transcript produces a soluble protein present at much lower levels. Additional, alternatively spliced transcript variants have been described, but their biological validity has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,618 Da
NCBI Official Full Name
complement decay-accelerating factor, GPI-anchored preproprotein
NCBI Official Synonym Full Names
CD55 molecule, decay accelerating factor for complement
NCBI Official Symbol
Cd55
NCBI Official Synonym Symbols
Daf; Daf1; Daf-GPI; GPI-DAF
NCBI Protein Information
complement decay-accelerating factor, GPI-anchored
UniProt Protein Name
Complement decay-accelerating factor, GPI-anchored
UniProt Gene Name
Cd55
UniProt Synonym Gene Names
Cd55a; Daf; Daf1; DAF-GPI

NCBI Description

This gene encodes an inhibitor of both the classical and the alternative pathways of complement activation. The encoded preproprotein undergoes post-translational processing to generate a mature polypeptide anchored to the plasma membrane via a glycosylphosphatidylinositol moiety. Erythrocytes from mice deficient in the encoded protein exhibit impaired regulation of complement activation resulting in enhanced complement deposition. Mice lacking the encoded protein exhibit enhanced susceptibility to experimentally induced myasthenia gravis. This gene is located adjacent to a closely related gene on chromosome 1. [provided by RefSeq, Nov 2015]

Uniprot Description

This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. Inhibits complement activation by destabilizing and preventing the formation of C3 and C5 convertases, which prevents complement damage.

Research Articles on Cd55

Similar Products

Product Notes

The Cd55 cd55 (Catalog #AAA1378648) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 35-362, full length protein. The amino acid sequence is listed below: DCGPPPDIPN ARPILGRHSK FAEQSKVAYS CNNGFKQVPD KSNIVVCLEN GQWSSHETFC EKSCVAPERL SFASLKKEYL NMNFFPVGTI VEYECRPGFR KQPPLPGKAT CLEDLVWSPV AQFCKKKSCP NPKDLDNGHI NIPTGILFGS EINFSCNPGY RLVGVSSTFC SVTGNTVDWD DEFPVCTEIH CPEPPKINNG IMRGESDSYT YSQVVTYSCD KGFILVGNAS IYCTVSKSDV GQWSSPPPRC IEKSKVPTKK PTINVPSTGT PSTPQKPTTE SVPNPGDQPT PQKPSTVKVS ATQHVPVTKT TVRHPIRTST DKGEPNTG. It is sometimes possible for the material contained within the vial of "Complement decay-accelerating factor, GPI-anchored (Cd55), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.