Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Leukocyte surface antigen CD53 (CD53) Recombinant Protein | CD53 recombinant protein

Recombinant Human Leukocyte surface antigen CD53 (CD53)

Gene Names
CD53; MOX44; TSPAN25
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Leukocyte surface antigen CD53 (CD53); Recombinant Human Leukocyte surface antigen CD53 (CD53); Recombinant Leukocyte surface antigen CD53 (CD53); Leukocyte surface antigen CD53; Cell surface glycoprotein CD53 Tetraspanin-25; Tspan-25 CD_antigen= CD53; CD53 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-219
Sequence
MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL
Sequence Length
219
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
963
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,341 Da
NCBI Official Full Name
leukocyte surface antigen CD53
NCBI Official Synonym Full Names
CD53 molecule
NCBI Official Symbol
CD53
NCBI Official Synonym Symbols
MOX44; TSPAN25
NCBI Protein Information
leukocyte surface antigen CD53; tspan-25; CD53 antigen; tetraspanin-25; CD53 glycoprotein; cell surface antigen; CD53 tetraspan antigen; transmembrane glycoprotein; cell surface glycoprotein CD53; antigen MOX44 identified by monoclonal antibody MRC-OX44
UniProt Protein Name
Leukocyte surface antigen CD53
Protein Family
UniProt Gene Name
CD53
UniProt Synonym Gene Names
MOX44; TSPAN25; Tspan-25
UniProt Entry Name
CD53_HUMAN

NCBI Description

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. It contributes to the transduction of CD2-generated signals in T cells and natural killer cells and has been suggested to play a role in growth regulation. Familial deficiency of this gene has been linked to an immunodeficiency associated with recurrent infectious diseases caused by bacteria, fungi and viruses. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]

Uniprot Description

CD53: May be involved in growth regulation in hematopoietic cells. Belongs to the tetraspanin (TM4SF) family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 1p13

Cellular Component: cell surface; integral to membrane; plasma membrane; immunological synapse; intercellular junction

Molecular Function: protein binding

Biological Process: signal transduction

Research Articles on CD53

Similar Products

Product Notes

The CD53 cd53 (Catalog #AAA953970) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-219. The amino acid sequence is listed below: MGMSSLKLLK YVLFFFNLLF WICGCCILGF GIYLLIHNNF GVLFHNLPSL TLGNVFVIVG SIIMVVAFLG CMGSIKENKC LLMSFFILLL IILLAEVTLA ILLFVYEQKL NEYVAKGLTD SIHRYHSDNS TKAAWDSIQS FLQCCGINGT SDWTSGPPAS CPSDRKVEGC YAKARLWFHS NFLYIGIITI CVCVIEVLGM SFALTLNCQI DKTSQTIGL. It is sometimes possible for the material contained within the vial of "Leukocyte surface antigen CD53 (CD53), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.