Complement C5 (C5) Recombinant Protein | C5 recombinant protein

Recombinant Rat Complement C5 (C5)

Cat. Num. AAA950846

• Gene Names: C5; Hc; C5a; RGD1561905
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Complement C5 (C5); Recombinant Rat Complement C5 (C5); C5 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-77. Full length.
• Sequence: DLQLLHQKVEEQAAKYKHRVPKKCCYDGARENKYETCEQRVARVTIGPHCIRAFNECCTIADKIRKESHHKGMLLGR
• Sequence Length: 77

• Species: Rat
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for C5 recombinant protein

This protein is the fifth component of complement, which plays an important role in inflammatory and cell killing processes. This protein is comprised of alpha and beta polypeptide chains that are linked by a disulfide bridge. An activation peptide, C5a, which is an anaphylatoxin that possesses potent spasmogenic and chemotactic activity, is derived from the alpha polypeptide via cleavage with a convertase. The C5b macromolecular cleavage product can form a complex with the C6 complement component, and this complex is the basis for formation of the membrane attack complex, which includes additional complement components. Mutations in this gene cause complement component 5 deficiency, a disease where patients show a propensity for severe recurrent infections. Defects in this gene have also been linked to a susceptibility to liver fibrosis and to rheumatoid arthritis.

NCBI and Uniprot Product Information

• NCBI GI #: 46397770
• NCBI GeneID: 362119
• UniProt Accession #: P08650; Q63078
• Molecular Weight: 14.0 kDa
• NCBI Official Full Name: Complement C5
• NCBI Official Synonym Full Names: complement C5
• NCBI Official Symbol: C5
• NCBI Official Synonym Symbols: Hc; C5a; RGD1561905
• NCBI Protein Information: complement C5
• UniProt Protein Name: Complement C5
• Protein Family: Complement C5
• UniProt Gene Name: C5

NCBI Description

likely component of the classical pathway of the complement cascade; may be involved with tissue injury associated with ischemia or sepsis; may be a component of the membrane attack complex [RGD, Feb 2006]

Uniprot Description

Derived from proteolytic degradation of complement C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chemokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.