Fanconi anemia group J protein (BRIP1) Recombinant Protein | BRIP1 recombinant protein
Recombinant Human Fanconi anemia group J protein (BRIP1) , partial
Gene Names
BRIP1; OF; BACH1; FANCJ
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fanconi anemia group J protein (BRIP1); Recombinant Human Fanconi anemia group J protein (BRIP1); partial; BRIP1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-160. Partial
Sequence
SSMWSEYTIGGVKIYFPYKAYPSQLAMMNSILRGLNSKQHCLLESPTGSGKSLALLCSALAWQQSLSGKPADEGVSEKAEVQLSCCCACHSKDFTNNDMNQGTSRHFNYPSTPPSERNGTSSTCQDSPEKTTLAAKLSAKKQASIYRDENDDFQVEKKR
Sequence Length
160
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for BRIP1 recombinant protein
This protein is a member of the RecQ DEAH helicase family and interacts with the BRCT repeats of breast cancer, type 1 (BRCA1). The bound complex is important in the normal double-strand break repair function of breast cancer, type 1 (BRCA1). This gene may be a target of germline cancer-inducing mutations.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
112,476 Da
NCBI Official Full Name
Fanconi anemia group J protein
NCBI Official Synonym Full Names
BRCA1 interacting protein C-terminal helicase 1
NCBI Official Symbol
BRIP1
NCBI Official Synonym Symbols
OF; BACH1; FANCJ
NCBI Protein Information
Fanconi anemia group J protein
UniProt Protein Name
Fanconi anemia group J protein
Protein Family
UniProt Gene Name
BRIP1
UniProt Synonym Gene Names
BACH1; FANCJ; Protein FACJ; BRCA1-interacting protein 1
NCBI Description
The protein encoded by this gene is a member of the RecQ DEAH helicase family and interacts with the BRCT repeats of breast cancer, type 1 (BRCA1). The bound complex is important in the normal double-strand break repair function of breast cancer, type 1 (BRCA1). This gene may be a target of germline cancer-inducing mutations. [provided by RefSeq, Jul 2008]
Uniprot Description
DNA-dependent ATPase and 5' to 3' DNA helicase required for the maintenance of chromosomal stability. Acts late in the Fanconi anemia pathway, after FANCD2 ubiquitination. Involved in the repair of DNA double-strand breaks by homologous recombination in a manner that depends on its association with BRCA1.
Research Articles on BRIP1
Similar Products
Product Notes
The BRIP1 brip1 (Catalog #AAA1358544) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-160. Partial. The amino acid sequence is listed below: SSMWSEYTIG GVKIYFPYKA YPSQLAMMNS ILRGLNSKQH CLLESPTGSG KSLALLCSAL AWQQSLSGKP ADEGVSEKAE VQLSCCCACH SKDFTNNDMN QGTSRHFNYP STPPSERNGT SSTCQDSPEK TTLAAKLSAK KQASIYRDEN DDFQVEKKR . It is sometimes possible for the material contained within the vial of "Fanconi anemia group J protein (BRIP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
