Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: BRIP1Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

Rabbit anti-Human BRIP1 Polyclonal Antibody | anti-BRIP1 antibody

BRIP1 Antibody - N-terminal region

Gene Names
BRIP1; OF; BACH1; FANCJ
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
BRIP1; Polyclonal Antibody; BRIP1 Antibody - N-terminal region; anti-BRIP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FTNNDMNQGTSRHFNYPSTPPSERNGTSSTCQDSPEKTTLAAKLSAKKQA
Sequence Length
1249
Applicable Applications for anti-BRIP1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human BRIP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BRIP1Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BRIP1Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: BRIP1Sample Tissue: Human Thyroid Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BRIP1Sample Tissue: Human Thyroid Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-BRIP1 antibody
The protein encoded by this gene is a member of the RecQ DEAH helicase family and interacts with the BRCT repeats of breast cancer, type 1 (BRCA1). The bound complex is important in the normal double-strand break repair function of breast cancer, type 1 (BRCA1). This gene may be a target of germline cancer-inducing mutations.
Product Categories/Family for anti-BRIP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
137 kDa
NCBI Official Full Name
Fanconi anemia group J protein
NCBI Official Synonym Full Names
BRCA1 interacting protein C-terminal helicase 1
NCBI Official Symbol
BRIP1
NCBI Official Synonym Symbols
OF; BACH1; FANCJ
NCBI Protein Information
Fanconi anemia group J protein
UniProt Protein Name
Fanconi anemia group J protein
UniProt Gene Name
BRIP1
UniProt Synonym Gene Names
BACH1; FANCJ; Protein FACJ; BRCA1-interacting protein 1
UniProt Entry Name
FANCJ_HUMAN

NCBI Description

The protein encoded by this gene is a member of the RecQ DEAH helicase family and interacts with the BRCT repeats of breast cancer, type 1 (BRCA1). The bound complex is important in the normal double-strand break repair function of breast cancer, type 1 (BRCA1). This gene may be a target of germline cancer-inducing mutations. [provided by RefSeq, Jul 2008]

Uniprot Description

BRIP1: a DNA-dependent ATPase and DNA helicase required for the maintenance of chromosomal stability. Involved in the repair of DNA double-strand breaks by homologous recombination in a manner that depends on its association with BRCA1. Binds directly to the BRCT domains of BRCA1. Defects in BRIP1 cause of susceptibility to breast cancer and Fanconi anemia. Acts late in the Fanconi anemia pathway, after FANCD2 ubiquitination. Belongs to the DEAD box helicase family, DEAH subfamily. Two alternatively spliced human isoforms have been described.

Protein type: Oncoprotein; Helicase; EC 3.6.4.13

Chromosomal Location of Human Ortholog: 17q22.2

Cellular Component: nuclear membrane; cytoplasm; nucleus

Molecular Function: ATP-dependent DNA helicase activity; protein binding; DNA binding; metal ion binding; 4 iron, 4 sulfur cluster binding; ATP binding

Biological Process: regulation of transcription from RNA polymerase II promoter; double-strand break repair; DNA damage checkpoint; DNA duplex unwinding

Disease: Fanconi Anemia, Complementation Group J; Breast Cancer; Tracheoesophageal Fistula With Or Without Esophageal Atresia

Research Articles on BRIP1

Similar Products

Product Notes

The BRIP1 brip1 (Catalog #AAA3221600) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BRIP1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BRIP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BRIP1 brip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FTNNDMNQGT SRHFNYPSTP PSERNGTSST CQDSPEKTTL AAKLSAKKQA. It is sometimes possible for the material contained within the vial of "BRIP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.