Adenine Nucleotide Translocator 2 Blocking Peptide | ANXA1 blocking peptide
Adenine Nucleotide Translocator 2 Peptide
Immunocytochemistry: 1:100
Immunofluorescence: 1:100
Immunohistochemistry: 1:100
Western Blot: 1:500
Sequence: AEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAK
Catalyzes exchange of cytoplasmic ADP with mitochondrial ATP across mitochondrial inner membrane. May also play role in chromosome segregation.
NCBI and Uniprot Product Information
NCBI Description
This gene encodes a membrane-localized protein that binds phospholipids. This protein inhibits phospholipase A2 and has anti-inflammatory activity. Loss of function or expression of this gene has been detected in multiple tumors. [provided by RefSeq, Dec 2014]
Uniprot Description
ANXA1: a calcium/phospholipid-binding protein with which promotes membrane fusion and is involved in endocytosis. Has anti-inflammatory properties and inhibits phospholipase A2 activity. Accumulates on internalized vesicles after EGF-stimulated endocytosis, suggesting that it may be required for a late stage in inward vesiculation. Phosphorylated by PKC, EGFR and Chak1. Phosphorylation results in loss of the inhibitory activity. Annexins are a family of structurally related proteins whose common property is calcium-dependent binding to phospholipids. There are at least ten different annexins in mammalian species. Annexins do not contain signal peptides, yet some annexins (A1, A2 and A5) appear to be secreted in a physiologically regulated fashion.
Protein type: Calcium-binding; Lipid-binding
Chromosomal Location of Human Ortholog: 9q21.13
Cellular Component: apical plasma membrane; basolateral plasma membrane; cell surface; cornified envelope; cytoplasm; cytoplasmic vesicle membrane; early endosome membrane; endosome; extracellular region; extracellular space; extrinsic to external side of plasma membrane; extrinsic to membrane; focal adhesion; lateral plasma membrane; mast cell granule; mitochondrial membrane; nucleoplasm; nucleus; phagocytic cup; plasma membrane; protein complex; sarcolemma; vesicle
Molecular Function: calcium ion binding; calcium-dependent phospholipid binding; calcium-dependent protein binding; double-stranded DNA-dependent ATPase activity; helicase activity; phospholipase A2 inhibitor activity; phospholipid binding; protein binding; protein binding, bridging; protein homodimerization activity; receptor binding; single-stranded DNA binding; single-stranded RNA binding; structural molecule activity
Biological Process: actin cytoskeleton reorganization; adaptive immune response; alpha-beta T cell differentiation; arachidonic acid secretion; cell surface receptor linked signal transduction; DNA duplex unwinding; DNA strand renaturation; endocrine pancreas development; G-protein signaling, coupled to cyclic nucleotide second messenger; gliogenesis; inflammatory response; innate immune response; insulin secretion; keratinocyte differentiation; monocyte chemotaxis; myoblast migration involved in skeletal muscle regeneration; negative regulation of apoptosis; negative regulation of exocytosis; negative regulation of T-helper 2 cell differentiation; neutrophil homeostasis; peptide cross-linking; phagocytosis; positive regulation of interleukin-2 production; positive regulation of neutrophil apoptosis; positive regulation of prostaglandin biosynthetic process; positive regulation of T cell proliferation; positive regulation of T-helper 1 cell differentiation; positive regulation of vesicle fusion; prostate gland development; regulation of cell shape; regulation of hormone secretion; regulation of inflammatory response; regulation of interleukin-1 production; regulation of leukocyte migration; response to drug; response to estradiol stimulus; response to peptide hormone stimulus; response to X-ray; signal transduction
Research Articles on ANXA1
Similar Products
Product Notes
The ANXA1 anxa1 (Catalog #AAA542356) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Adenine Nucleotide Translocator 2 can be used in a range of immunoassay formats including, but not limited to, Immunocompetition, Immunodepletion. Confocal Microscopy||1:100 Immunocytochemistry: 1:100 Immunofluorescence: 1:100 Immunohistochemistry: 1:100 Western Blot: 1:500. Researchers should empirically determine the suitability of the ANXA1 anxa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Adenine Nucleotide Translocator 2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
