Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TympSample Type: Rat Liver lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Tymp Polyclonal Antibody | anti-TYMP antibody

Tymp Antibody - N-terminal region

Gene Names
Tymp; Ecgf1
Reactivity
Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Tymp; Polyclonal Antibody; Tymp Antibody - N-terminal region; anti-TYMP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AESGQQLEWPKAWHQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISG
Sequence Length
476
Applicable Applications for anti-TYMP antibody
Western Blot (WB)
Homology
Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Tymp
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TympSample Type: Rat Liver lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TympSample Type: Rat Liver lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TYMP antibody
This is a rabbit polyclonal antibody against Tymp. It was validated on Western Blot

Target Description: Tymp catalyzes the reversible phosphorolysis of thymidine. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.
Product Categories/Family for anti-TYMP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
thymidine phosphorylase
NCBI Official Synonym Full Names
thymidine phosphorylase
NCBI Official Symbol
Tymp
NCBI Official Synonym Symbols
Ecgf1
NCBI Protein Information
thymidine phosphorylase
UniProt Protein Name
Thymidine phosphorylase
UniProt Gene Name
Tymp
UniProt Synonym Gene Names
Ecgf1; TP
UniProt Entry Name
TYPH_RAT

Uniprot Description

ECGF1: May have a role in maintaining the integrity of the blood vessels. Has growth promoting activity on endothelial cells, angiogenic activity in vivo and chemotactic activity on endothelial cells in vitro. Homodimer. Belongs to the thymidine/pyrimidine-nucleoside phosphorylase family.

Protein type: Xenobiotic Metabolism - drug metabolism - other enzymes; Nucleotide Metabolism - pyrimidine; Phosphorylase; Cytokine; EC 2.4.2.4; Transferase; Motility/polarity/chemotaxis; DNA replication

Molecular Function: thymidine phosphorylase activity; phosphorylase activity; transferase activity, transferring pentosyl groups; pyrimidine-nucleoside phosphorylase activity

Biological Process: pyrimidine base metabolic process; pyrimidine nucleoside metabolic process

Research Articles on TYMP

Similar Products

Product Notes

The TYMP tymp (Catalog #AAA3209073) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Tymp Antibody - N-terminal region reacts with Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Tymp can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TYMP tymp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AESGQQLEWP KAWHQQLVDK HSTGGVGDKV SLVLAPALAA CGCKVPMISG. It is sometimes possible for the material contained within the vial of "Tymp, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.