Vasopressin V1b receptor (AVPR1B) Recombinant Protein | AVPR1B recombinant protein
Recombinant Human Vasopressin V1b receptor (AVPR1B)
Gene Names
AVPR1B; V1bR; AVPR3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Vasopressin V1b receptor (AVPR1B); Recombinant Human Vasopressin V1b receptor (AVPR1B); AVPR1B recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-424, Full length protein
Sequence
MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLGQLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVGGGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSVQMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQPRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAETIIF
Sequence Length
424
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for AVPR1B recombinant protein
This protein acts as receptor for arginine vasopressin. This receptor belongs to the subfamily of G-protein coupled receptors which includes AVPR1A, V2R and OXT receptors. Its activity is mediated by G proteins which stimulate a phosphatidylinositol-calcium second messenger system. The receptor is primarily located in the anterior pituitary, where it stimulates ACTH release. It is expressed at high levels in ACTH-secreting pituitary adenomas as well as in bronchial carcinoids responsible for the ectopic ACTH syndrome. A spliced antisense transcript of this gene has been reported but its function is not known.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
46,971 Da
NCBI Official Full Name
vasopressin V1b receptor
NCBI Official Synonym Full Names
arginine vasopressin receptor 1B
NCBI Official Symbol
AVPR1B
NCBI Official Synonym Symbols
V1bR; AVPR3
NCBI Protein Information
vasopressin V1b receptor
UniProt Protein Name
Vasopressin V1b receptor
Protein Family
UniProt Gene Name
AVPR1B
UniProt Synonym Gene Names
AVPR3; VPR3; V1bR
NCBI Description
The protein encoded by this gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily of G-protein coupled receptors which includes AVPR1A, V2R and OXT receptors. Its activity is mediated by G proteins which stimulate a phosphatidylinositol-calcium second messenger system. The receptor is primarily located in the anterior pituitary, where it stimulates ACTH release. It is expressed at high levels in ACTH-secreting pituitary adenomas as well as in bronchial carcinoids responsible for the ectopic ACTH syndrome. A spliced antisense transcript of this gene has been reported but its function is not known. [provided by RefSeq, Jul 2008]
Uniprot Description
Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system.
Research Articles on AVPR1B
Similar Products
Product Notes
The AVPR1B avpr1b (Catalog #AAA960289) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-424, Full length protein. The amino acid sequence is listed below: MDSGPLWDAN PTPRGTLSAP NATTPWLGRD EELAKVEIGV LATVLVLATG GNLAVLLTLG QLGRKRSRMH LFVLHLALTD LAVALFQVLP QLLWDITYRF QGPDLLCRAV KYLQVLSMFA STYMLLAMTL DRYLAVCHPL RSLQQPGQST YLLIAAPWLL AAIFSLPQVF IFSLREVIQG SGVLDCWADF GFPWGPRAYL TWTTLAIFVL PVTMLTACYS LICHEICKNL KVKTQAWRVG GGGWRTWDRP SPSTLAATTR GLPSRVSSIN TISRAKIRTV KMTFVIVLAY IACWAPFFSV QMWSVWDKNA PDEDSTNVAF TISMLLGNLN SCCNPWIYMG FNSHLLPRPL RHLACCGGPQ PRMRRRLSDG SLSSRHTTLL TRSSCPATLS LSLSLTLSGR PRPEESPRDL ELADGEGTAE TIIF. It is sometimes possible for the material contained within the vial of "Vasopressin V1b receptor (AVPR1B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
