DNA dC->dU-editing enzyme APOBEC-3F (APOBEC3F) Recombinant Protein | APOBEC3F recombinant protein

Recombinant Human DNA dC->dU-editing enzyme APOBEC-3F (APOBEC3F)

Cat. Num. AAA1312704

• Gene Names: APOBEC3F; A3F; KA6; ARP8; BK150C2.4.MRNA
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: DNA dC->dU-editing enzyme APOBEC-3F (APOBEC3F); Recombinant Human DNA dC->dU-editing enzyme APOBEC-3F (APOBEC3F); APOBEC3F recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-373, Full length protein
• Sequence: MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYSQPEHHAEMCFLSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLAEHPNVTLTISAARLYYYWERDYRRALCRLSQAGARVKIMDDEEFAYCWENFVYSEGQPFMPWYKFDDNYAFLHRTLKEILRNPMEAMYPHIFYFHFKNLRKAYGRNESWLCFTMEVVKHHSPVSWKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLTIFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYNFLFLDSKLQEILE
• Sequence Length: 373

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for APOBEC3F recombinant protein

This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified.

NCBI and Uniprot Product Information

• NCBI GI #: 54873619
• NCBI GeneID: 200316
• NCBI Accession #: NP_001006667.1
• NCBI GenBank Nucleotide #: NM_001006666.1
• UniProt Accession #: Q8IUX4; Q45F03; Q6ICH3; Q7Z2N2; Q7Z2N5; B0QYD4
• Molecular Weight: 11,823 Da
• NCBI Official Full Name: DNA dC->dU-editing enzyme APOBEC-3F isoform b
• NCBI Official Synonym Full Names: apolipoprotein B mRNA editing enzyme catalytic subunit 3F
• NCBI Official Symbol: APOBEC3F
• NCBI Official Synonym Symbols: A3F; KA6; ARP8; BK150C2.4.MRNA
• NCBI Protein Information: DNA dC->dU-editing enzyme APOBEC-3F
• UniProt Protein Name: DNA dC->dU-editing enzyme APOBEC-3F
• Protein Family: DNA dC->dU-editing enzyme
• UniProt Gene Name: APOBEC3F
• UniProt Synonym Gene Names: A3F

NCBI Description

This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

DNA deaminase (cytidine deaminase) which acts as an inhibitor of retrovirus replication and retrotransposon mobility via deaminase-dependent and -independent mechanisms. Exhibits antiviral activity against vif-deficient HIV-1. After the penetration of retroviral nucleocapsids into target cells of infection and the initiation of reverse transcription, it can induce the conversion of cytosine to uracil in the minus-sense single-strand viral DNA, leading to G-to-A hypermutations in the subsequent plus-strand viral DNA. The resultant detrimental levels of mutations in the proviral genome, along with a deamination-independent mechanism that works prior to the proviral integration, together exert efficient antiretroviral effects in infected target cells. Selectively targets single-stranded DNA and does not deaminate double-stranded DNA or single- or double-stranded RNA. Exhibits antiviral activity also against hepatitis B virus (HBV), equine infectious anemia virus (EIAV), xenotropic MuLV-related virus (XMRV) and simian foamy virus (SFV) and may inhibit the mobility of LTR and non-LTR retrotransposons. May also play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation.