Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-APOBEC3F Polyclonal Antibody)

Rabbit anti-Human APOBEC3F Polyclonal Antibody | anti-APOBEC3F antibody

APOBEC3F Polyclonal Antibody

Gene Names
APOBEC3F; A3F; KA6; ARP8; BK150C2.4.MRNA
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
APOBEC3F; Polyclonal Antibody; APOBEC3F Polyclonal Antibody; A3F; ARP8; BK150C2.4.MRNA; KA6; DNA dC->dU-editing enzyme APOBEC-3F; anti-APOBEC3F antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
0.58 mg/ml (varies by lot)
Sequence Length
373
Applicable Applications for anti-APOBEC3F antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 189-373 of human APOBEC3F (NP_660341.2).
Immunogen Sequence
RNPMEAMYPHIFYFHFKNLRKAYGRNESWLCFTMEVVKHHSPVSWKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLTIFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYNFLFLDSKLQEILE
Positive Samples
PC-3
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-APOBEC3F Polyclonal Antibody)

Western Blot (WB) (Western blot-APOBEC3F Polyclonal Antibody)
Related Product Information for anti-APOBEC3F antibody
This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated: 9kDa; 11kDa; 45kDa
Observed: 45kDa
NCBI Official Full Name
DNA dC->
NCBI Official Synonym Full Names
apolipoprotein B mRNA editing enzyme catalytic subunit 3F
NCBI Official Symbol
APOBEC3F
NCBI Official Synonym Symbols
A3F; KA6; ARP8; BK150C2.4.MRNA
NCBI Protein Information
DNA dC->dU-editing enzyme APOBEC-3F
UniProt Protein Name
DNA dC->dU-editing enzyme APOBEC-3F
Protein Family
UniProt Gene Name
APOBEC3F
UniProt Synonym Gene Names
A3F
UniProt Entry Name
ABC3F_HUMAN

NCBI Description

This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

APOBEC3F: Host cellular restriction factor that may have antiviral activities against exogenous and endogenous viruses, as well as retrotransposons. After being packaged into HIV-1 virions, blocks productive infection by massively editing dC residues to dU on the DNA minus strand during reverse transcription. The editing of the minus strand DNA of HIV-1 during reverse transcription leads to G- to-A transitions in the plus strand. The inhibition of viral replication is either due to the degradation of the minus strand before its integration or to the lethality of the hypermutations. May also play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation. Belongs to the cytidine and deoxycytidylate deaminase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA processing; Hydrolase; EC 3.5.4.-

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: apolipoprotein B mRNA editing enzyme complex; cytoplasm; ribonucleoprotein complex

Molecular Function: protein binding; zinc ion binding; RNA binding; cytidine deaminase activity

Biological Process: negative regulation of retroviral genome replication; base conversion or substitution editing; negative regulation of viral genome replication; innate immune response; cytidine deamination; positive regulation of defense response to virus by host; negative regulation of viral reproduction; defense response to virus

Research Articles on APOBEC3F

Similar Products

Product Notes

The APOBEC3F apobec3f (Catalog #AAA9141077) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOBEC3F Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APOBEC3F can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the APOBEC3F apobec3f for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "APOBEC3F, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.