Apolipoprotein A-I (Apoa1) Recombinant Protein | Apoa1 recombinant protein

Recombinant Mouse Apolipoprotein A-I (Apoa1)

Cat. Num. AAA954950

• Gene Names: Apoa1; Sep2; Alp-1; Ltw-1; Sep-1; Sep-2; Apoa-1; Brp-14; Lvtw-1; apo-AI; apoA-I
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Apolipoprotein A-I (Apoa1); Recombinant Mouse Apolipoprotein A-I (Apoa1); Apoa1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 25-264, Full length protein
• Sequence: DEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTQVQSVIDKASETLTAQ
• Sequence Length: 240

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Apoa1 recombinant protein

This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The protein promotes cholesterol efflux from tissues to the liver for excretion, and it is a cofactor for lecithin cholesterolacyltransferase (LCAT) which is responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis.

NCBI and Uniprot Product Information

• NCBI GI #: 160333304
• NCBI GeneID: 11806
• NCBI Accession #: NP_033822.2
• NCBI GenBank Nucleotide #: NM_009692.4
• UniProt Accession #: Q00623; O08855; O09042; Q8BPD5
• Molecular Weight: 30,616 Da
• NCBI Official Full Name: apolipoprotein A-I preproprotein
• NCBI Official Synonym Full Names: apolipoprotein A-I
• NCBI Official Symbol: Apoa1
• NCBI Official Synonym Symbols: Sep2; Alp-1; Ltw-1; Sep-1; Sep-2; Apoa-1; Brp-14; Lvtw-1; apo-AI; apoA-I
• NCBI Protein Information: apolipoprotein A-I
• UniProt Protein Name: Apolipoprotein A-I
• Protein Family: Apolipoprotein
• UniProt Gene Name: Apoa1
• UniProt Synonym Gene Names: Apo-AI; ApoA-I; ProapoA-I

NCBI Description

This gene encodes a preproprotein that is proteolytically cleaved to yield a signal peptide and a proproptein that is subsequently processed to generate the active mature peptide. The encoded protein is the major protein component of plasma high density lipoprotein (HDL). This protein facilitates the removal of cholesterol and other fats from tissues by transporting them to the liver for excretion. This protein is a cofactor for lecithin cholesterolacyltransferase, an enzyme that catalyzes the conversion of free cholesterol to cholesteryl esters. Mutations in this gene in humans causes familial HDL deficiency, Tangier disease and familial visceral amyloidosis. Similar clinical features are exhibited by mice with mutations in this gene. This gene is clustered with three other apolipoprotein genes on chromosome 9. [provided by RefSeq, Dec 2013]

Uniprot Description

Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility.