Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Sequence Information

Angiopoietin Like Protein 4 (ANGPTL4) Recombinant Protein | ANGPTL4 recombinant protein

Recombinant Angiopoietin Like Protein 4 (ANGPTL4)

Applications
SDS-Page, Western Blot, ELISA, Immunoprecipitation
Purity
> 95%
Synonyms
Angiopoietin Like Protein 4 (ANGPTL4); Recombinant Angiopoietin Like Protein 4 (ANGPTL4); ANGPTL4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
> 95%
Form/Format
Supplied as lyophilized form in PBS,pH7.4, containing 5% sucrose, 0.01% sarcosyl.
Sequence
The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-RPPRDCQEL FQEGERHSGL FQIQPLGSPP FLVNCEMTSD GGWTVIQRRL NGSVDFNQSW EAYKDGFGDP QGEFWLGLEK MHSITGDRGS QLAVQLQDWD GNAKLLQFPI HLGGEDTAYS LQLTEPTANE LGATNVSPNG LSLPFSTWDQ DHDLRGDLNC AKSLSGGWWF GTCSHSNLNG QYFHSIPRQR QQRKKGIFWK TWKGRYYPLQ ATTL
Sequence Length
405
Applicable Applications for ANGPTL4 recombinant protein
SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Organism
Rattus norvegicus (Rat)
Expression System
Prokaryotic expression
Residues
Arg182~Leu394 (Accession # Q6TMA8) with two N-terminal Tags, His-tag and S-tag
Endotoxin Level
<1.0EU per 1ug (determined by the LAL method)
Reconstitution
Reconstitute in sterile PBS, pH7.2-pH7.4.
Preparation and Storage
Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.

Sequence Information

Sequence Information

SDS-Page

SDS-Page

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29.8kDa
NCBI Official Full Name
angiopoietin-related protein 4
NCBI Official Synonym Full Names
angiopoietin-like 4
NCBI Official Symbol
Angptl4
NCBI Protein Information
angiopoietin-related protein 4; HFARP; angiopoietin-like protein 4; hepatic fibrinogen/angiopoietin-related protein
UniProt Protein Name
Angiopoietin-related protein 4
UniProt Gene Name
Angptl4
UniProt Synonym Gene Names
HFARP
UniProt Entry Name
ANGL4_RAT

NCBI Description

a circulating protein which causes an increase in plasma very low density lipoprotein by inhibition of lipoprotein lipase activity [RGD, Feb 2006]

Uniprot Description

Function: Protein with hypoxia-induced expression in endothelial cells. May act as a regulator of angiogenesis and modulate tumorigenesis. Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. May exert a protective function on endothelial cells through an endocrine action. It is directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity. In response to hypoxia, the unprocessed form of the protein accumulates in the subendothelial extracellular matrix (ECM). The matrix-associated and immobilized unprocessed form limits the formation of actin stress fibers and focal contacts in the adhering endothelial cells and inhibits their adhesion. It also decreases motility of endothelial cells and inhibits the sprouting and tube formation

By similarity.

Subunit structure: Homooligomer. The homooligomer undergoes proteolytic processing to release its carboxyl fibrinogen-like domain, which circulates as a monomer. The homooligomer unprocessed form is able to interact with the extracellular matrix

By similarity. Ref.1

Subcellular location: Secreted. Secreted › extracellular space › extracellular matrix. Note: The unprocessed form interacts with the extracellular matrix. This may constitute a dynamic reservoir, a regulatory mechanism of the bioavailability of ANGPTL4

By similarity.

Post-translational modification: N-glycosylated

By similarity.

Sequence similarities: Contains 1 fibrinogen C-terminal domain.

Research Articles on ANGPTL4

Similar Products

Product Notes

The ANGPTL4 angptl4 (Catalog #AAA2009047) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Angiopoietin Like Protein 4 (ANGPTL4) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the ANGPTL4 angptl4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-RPPRDCQ EL FQEGERHSGL FQIQPLGSPP FLVNCEMTSD GGWTVIQRRL NGSVDFNQSW EAYKDGFGDP QGEFWLGLEK MHSITGDRGS QLAVQLQDWD GNAKLLQFPI HLGGEDTAYS LQLTEPTANE LGATNVSPNG LSLPFSTWDQ DHDLRGDLNC AKSLSGGWWF GTCSHSNLNG QYFHSIPRQR QQRKKGIFWK TWKGRYYPLQ ATTL. It is sometimes possible for the material contained within the vial of "Angiopoietin Like Protein 4 (ANGPTL4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.