Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Angiopoietin-related protein 4 (ANGPTL4) Recombinant Protein | ANGPTL4 recombinant protein

Recombinant Human Angiopoietin-related protein 4 (ANGPTL4)

Gene Names
ANGPTL4; NL2; ARP4; FIAF; HARP; PGAR; HFARP; TGQTL; UNQ171; pp1158
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Angiopoietin-related protein 4 (ANGPTL4); Recombinant Human Angiopoietin-related protein 4 (ANGPTL4); ANGPTL4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-406. Full Length of Mature Protein
Sequence
GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for ANGPTL4 recombinant protein
This gene is a member of the angiopoietin
angiopoietin-like gene family and encodes a glycosylated, secreted protein with a fibrinogen C-terminal domain. This gene is induced under hypoxic conditions in endothelial cells and is the target of peroxisome proliferation activators. The encoded protein is a serum hormone directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity and also acts as an apoptosis survival factor for vascular endothelial cells. The encoded protein may play a role in several cancers and it also has been shown to prevent the metastatic process by inhibiting vascular activity as well as tumor cell motility and invasiveness. Decreased expression of this protein has been associated with type 2 diabetes. Alternatively spliced transcript variants encoding different isoforms have been described. This gene was previously referred to as ANGPTL2 but has been renamed ANGPTL4.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26,853 Da
NCBI Official Full Name
angiopoietin-related protein 4 isoform b
NCBI Official Synonym Full Names
angiopoietin like 4
NCBI Official Symbol
ANGPTL4
NCBI Official Synonym Symbols
NL2; ARP4; FIAF; HARP; PGAR; HFARP; TGQTL; UNQ171; pp1158
NCBI Protein Information
angiopoietin-related protein 4
UniProt Protein Name
Angiopoietin-related protein 4
UniProt Gene Name
ANGPTL4
UniProt Synonym Gene Names
ARP4; HFARP; PGAR; HFARP

NCBI Description

This gene encodes a glycosylated, secreted protein containing a C-terminal fibrinogen domain. The encoded protein is induced by peroxisome proliferation activators and functions as a serum hormone that regulates glucose homeostasis, lipid metabolism, and insulin sensitivity. This protein can also act as an apoptosis survival factor for vascular endothelial cells and can prevent metastasis by inhibiting vascular growth and tumor cell invasion. The C-terminal domain may be proteolytically-cleaved from the full-length secreted protein. Decreased expression of this gene has been associated with type 2 diabetes. Alternative splicing results in multiple transcript variants. This gene was previously referred to as ANGPTL2 but has been renamed ANGPTL4. [provided by RefSeq, Sep 2013]

Uniprot Description

Protein with hypoxia-induced expression in endothelial cells. May act as a regulator of angiogenesis and modulate tumorigenesis. Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. May exert a protective function on endothelial cells through an endocrine action. It is directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity. In response to hypoxia, the unprocessed form of the protein accumulates in the subendothelial extracellular matrix (ECM). The matrix-associated and immobilized unprocessed form limits the formation of actin stress fibers and focal contacts in the adhering endothelial cells and inhibits their adhesion. It also decreases motility of endothelial cells and inhibits the sprouting and tube formation ().

Research Articles on ANGPTL4

Similar Products

Product Notes

The ANGPTL4 angptl4 (Catalog #AAA1327108) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-406. Full Length of Mature Protein. The amino acid sequence is listed below: GPVQSKSPRF ASWDEMNVLA HGLLQLGQGL REHAERTRSQ LSALERRLSA CGSACQGTEG STDLPLAPES RVDPEVLHSL QTQLKAQNSR IQQLFHKVAQ QQRHLEKQHL RIQHLQSQFG LLDHKHLDHE VAKPARRKRL PEMAQPVDPA HNVSRLHRLP RDCQELFQVG ERQSGLFEIQ PQGSPPFLVN CKMTSDGGWT VIQRRHDGSV DFNRPWEAYK AGFGDPHGEF WLGLEKVHSI TGDRNSRLAV QLRDWDGNAE LLQFSVHLGG EDTAYSLQLT APVAGQLGAT TVPPSGLSVP FSTWDQDHDL RRDKNCAKSL SGGWWFGTCS HSNLNGQYFR SIPQQRQKLK KGIFWKTWRG RYYPLQATTM LIQPMAAEAA S . It is sometimes possible for the material contained within the vial of "Angiopoietin-related protein 4 (ANGPTL4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.