Allograft inflammatory factor 1 Recombinant Protein | Aif1 recombinant protein

Recombinant Rat Allograft inflammatory factor 1

Cat. Num. AAA968075

• Gene Names: Aif1; iba1; Bart1; mrf-1; BART-1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Allograft inflammatory factor 1; Recombinant Rat Allograft inflammatory factor 1; Ionized calcium-binding adapter molecule 1; MRF-1; Microglia response factor; Aif1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-147aa; Full Length
• Sequence: SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP
• Sequence Length: 147

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Aif1 recombinant protein

Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play an role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.

Product Categories/Family for Aif1 recombinant protein

Neuroscience

References

Cloning and characterization of allograft inflammatory factor-1 a novel macrophage factor identified in rat cardiac allografts with chronic rejection.Utans U., Arceci R.J., Yamashita Y., Russell M.E.J. Clin. Invest. 95:2954-2962(1995) Use of differential display to identify differentially expressed mRNAs induced by rat carotid artery balloon angioplasty.Autieri M.V., Feuerstein G.Z., Yue T.-L., Ohlstein E.H., Douglas S.A.Lab. Invest. 72:656-661(1995) A novel gene iba1 in the major histocompatibility complex class III region encoding an EF hand protein expressed in a monocytic lineage.Imai Y., Ibata I., Ito D., Ohsawa K., Kohsaka S.Biochem. Biophys. Res. Commun. 224:855-862(1996) Upregulation of a new microglial gene, mrf-1, in response to programmed neuronal cell death and degeneration.Tanaka S., Suzuki K., Watanabe M., Matsuda A., Tone S., Koike T.J. Neurosci. 18:6358-6369(1998) The genomic sequence and comparative analysis of the rat major histocompatibility complex.Hurt P., Walter L., Sudbrak R., Klages S., Mueller I., Shiina T., Inoko H., Lehrach H., Guenther E., Reinhardt R., Himmelbauer H.Genome Res. 14:631-639(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 8392881
• NCBI GeneID: 29427
• NCBI Accession #: NP_058892.1
• NCBI GenBank Nucleotide #: NM_017196.3
• UniProt Accession #: P55009; P55007; P70491
• Molecular Weight: 18.7 kDa
• NCBI Official Full Name: allograft inflammatory factor 1
• NCBI Official Synonym Full Names: allograft inflammatory factor 1
• NCBI Official Symbol: Aif1
• NCBI Official Synonym Symbols: iba1; Bart1; mrf-1; BART-1
• NCBI Protein Information: allograft inflammatory factor 1
• UniProt Protein Name: Allograft inflammatory factor 1
• Protein Family: Apoptosis-inducing factor
• UniProt Gene Name: Aif1
• UniProt Synonym Gene Names: Iba1; Mrf1; AIF-1
• UniProt Entry Name: AIF1_RAT

NCBI Description

may play a role in macrophage activation and function [RGD, Feb 2006]

Uniprot Description

AIF1: Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T- lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal

Cellular Component: actin filament; cell projection; cytoplasm; cytosol; lamellipodium; nucleus; perikaryon; perinuclear region of cytoplasm; phagocytic cup; ruffle

Molecular Function: actin filament binding; calcium ion binding

Biological Process: actin filament bundle formation; actin filament polymerization; cellular response to extracellular stimulus; cellular response to hormone stimulus; inflammatory response; macrophage activation; negative regulation of apoptosis; negative regulation of smooth muscle cell proliferation; phagocytosis, engulfment; positive regulation of cell migration; positive regulation of muscle hyperplasia; positive regulation of nitric oxide biosynthetic process; positive regulation of protein amino acid phosphorylation; positive regulation of smooth muscle cell proliferation; positive regulation of T cell proliferation; Rac protein signal transduction; response to axon injury; response to cytokine stimulus; response to electrical stimulus; response to glucocorticoid stimulus