Mouse ANGPTL4 Monoclonal Antibody | anti-ANGPTL4 antibody

ANGPTL4 (Angiopoietin-like 4, ANGPTL2, ARP4, FIAF, HFARP, NL2, PGAR, pp1158) (Biotin)

Cat. Num. AAA6173806

• Gene Names: ANGPTL4; NL2; ARP4; FIAF; HARP; PGAR; HFARP; TGQTL; UNQ171; pp1158; ANGPTL2
• Applications: ELISA, Immunoprecipitation
• Purity: Purified
• Synonyms: ANGPTL4; Monoclonal Antibody; ANGPTL4 (Angiopoietin-like 4; ANGPTL2; ARP4; FIAF; HFARP; NL2; PGAR; pp1158) (Biotin); Angiopoietin-like 4; pp1158; anti-ANGPTL4 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1A12
• Specificity: Recognizes ANGPTL4.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-ANGPTL4 antibody: ELISA (EIA), Immunoprecipitation (IP)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ANGPTL4 (AAH23647.1, 26aa-406aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYHPLQATTMLIQPIAAEAAS
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of ANGPTL4 transfected lysate using anti-ANGPTL4 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ANGPTL4 MaxPab rabbit polyclonal antibody.)

Related Product Information for anti-ANGPTL4 antibody

This gene is a member of the angiopoietin/angiopoietin-like gene family and encodes a glycosylated, secreted protein with a fibrinogen C-terminal domain. This gene is induced under hypoxic conditions in endothelial cells and is the target of peroxisome proliferation activators. The encoded protein is a serum hormone directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity and also acts as an apoptosis survival factor for vascular endothelial cells. The encoded protein may play a role in several cancers and it also has been shown to prevent the metastatic process by inhibiting vascular activity as well as tumor cell motility and invasiveness. Decreased expression of this protein has been associated with type 2 diabetes. Alternatively spliced transcript variants encoding different isoforms have been described. This gene was previously referred to as ANGPTL2 but has been renamed ANGPTL4. [provided by RefSeq]

Product Categories/Family for anti-ANGPTL4 antibody

Antibodies; Angiopoietin

NCBI and Uniprot Product Information

• NCBI GI #: 23271126
• NCBI GeneID: 51129
• Molecular Weight: 26,853 Da
• NCBI Official Full Name: Angiopoietin-like 4
• NCBI Official Synonym Full Names: angiopoietin-like 4
• NCBI Official Symbol: ANGPTL4
• NCBI Official Synonym Symbols: NL2; ARP4; FIAF; HARP; PGAR; HFARP; TGQTL; UNQ171; pp1158; ANGPTL2
• NCBI Protein Information: angiopoietin-related protein 4; fasting-induced adipose factor; PPARG angiopoietin related protein; hepatic angiopoietin-related protein; hepatic fibrinogen/angiopoietin-related protein; peroxisome proliferator-activated receptor (PPAR) gamma induced angi
• Protein Family: Angiopoietin-related protein

NCBI Description

This gene encodes a glycosylated, secreted protein containing a C-terminal fibrinogen domain. The encoded protein is induced by peroxisome proliferation activators and functions as a serum hormone that regulates glucose homeostasis, lipid metabolism, and insulin sensitivity. This protein can also act as an apoptosis survival factor for vascular endothelial cells and can prevent metastasis by inhibiting vascular growth and tumor cell invasion. The C-terminal domain may be proteolytically-cleaved from the full-length secreted protein. Decreased expression of this gene has been associated with type 2 diabetes. Alternative splicing results in multiple transcript variants. This gene was previously referred to as ANGPTL2 but has been renamed ANGPTL4. [provided by RefSeq, Sep 2013]