Western Blot (WB)
(WB Suggested Anti-GRPEL1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Small Intestine)
Rabbit GRPEL1 Polyclonal Antibody | anti-GRPEL1 antibody
GRPEL1 antibody - N-terminal region
Gene Names
GRPEL1; GrpE; HMGE; mt-GrpE#1
Reactivity
Guinea Pig, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GRPEL1; Polyclonal Antibody; GRPEL1 antibody - N-terminal region; anti-GRPEL1 antibody
Host
Rabbit
Reactivity
Guinea Pig, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALAD
Sequence Length
217
Applicable Applications for anti-GRPEL1 antibody
Western Blot (WB)
Homology
Guinea Pig: 75%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GRPEL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-GRPEL1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Small Intestine)
Western Blot (WB)
(WB Suggested Anti-GRPEL1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Small Intestine)
Related Product Information for anti-GRPEL1 antibody
This is a rabbit polyclonal antibody against GRPEL1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: GRPEL1 is essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. GRPEL1 seems to control the nucleotide-depe
Target Description: GRPEL1 is essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. GRPEL1 seems to control the nucleotide-depe
Product Categories/Family for anti-GRPEL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
grpE protein homolog 1, mitochondrial
NCBI Official Synonym Full Names
GrpE like 1, mitochondrial
NCBI Official Symbol
GRPEL1
NCBI Official Synonym Symbols
GrpE; HMGE; mt-GrpE#1
NCBI Protein Information
grpE protein homolog 1, mitochondrial
UniProt Protein Name
GrpE protein homolog 1, mitochondrial
Protein Family
UniProt Gene Name
GRPEL1
UniProt Synonym Gene Names
GREPEL1
UniProt Entry Name
GRPE1_HUMAN
Uniprot Description
GRPEL1: Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. Belongs to the GrpE family.
Protein type: Mitochondrial; Chaperone
Chromosomal Location of Human Ortholog: 4p16
Cellular Component: mitochondrion; mitochondrial matrix
Molecular Function: protein homodimerization activity; adenyl-nucleotide exchange factor activity; chaperone binding; unfolded protein binding
Biological Process: cellular protein metabolic process; protein folding; regulation of catalytic activity; protein targeting to mitochondrion
Research Articles on GRPEL1
Similar Products
Product Notes
The GRPEL1 grpel1 (Catalog #AAA3208166) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRPEL1 antibody - N-terminal region reacts with Guinea Pig, Human and may cross-react with other species as described in the data sheet. AAA Biotech's GRPEL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GRPEL1 grpel1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NSGQNLEEDM GQSEQKADPP ATEKTLLEEK VKLEEQLKET VEKYKRALAD. It is sometimes possible for the material contained within the vial of "GRPEL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
