Testing Data (TD)
FAM150A (FAM150A) Recombinant Protein | FAM150A recombinant protein
Recombinant Human Protein FAM150A (FAM150A), partial
Gene Names
ALKAL1; AUGA; AUGB; FAM150A; UNQ9433
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
FAM150A (FAM150A); Recombinant Human Protein FAM150A (FAM150A); partial; FAM150A recombinant protein
Host
E Coli
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Tris-based buffer, 50% glycerol
Sequence Positions
Partial, 28-129
Sequence
RPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT
Calculated MW
27.5 kDa
Tag Info
N-terminal 6xHis-SUMO-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability
of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Testing Data (TD)
Testing Data (TD)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
ALK and LTK ligand 1
NCBI Official Synonym Full Names
ALK and LTK ligand 1
NCBI Official Symbol
ALKAL1
NCBI Official Synonym Symbols
AUGA; AUGB; FAM150A; UNQ9433
NCBI Protein Information
ALK and LTK ligand 1
UniProt Protein Name
ALK and LTK ligand 1
Protein Family
UniProt Gene Name
ALKAL1
UniProt Synonym Gene Names
AUG-beta
Uniprot Description
ALKAL1: Belongs to the FAM150 family.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 8q11.23
Molecular Function: protein binding; receptor signaling protein tyrosine kinase activator activity; receptor tyrosine kinase binding
Research Articles on FAM150A
Similar Products
Product Notes
The FAM150A alkal1 (Catalog #AAA9424044) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Partial, 28-129. The amino acid sequence is listed below: RPRGRRGARV TDKEPKPLLF LPAAGAGRTP SGSRSAEIFP RDSNLKDKFI KHFTGPVTFS PECSKHFHRL YYNTRECSTP AYYKRCARLL TRLAVSPLCS QT. It is sometimes possible for the material contained within the vial of "FAM150A (FAM150A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
