SDS-PAGE
ALK and LTK ligand 1 (ALKAL1) Recombinant Protein | ALKAL1 recombinant protein
Recombinant Human ALK and LTK ligand 1 (ALKAL1)
Gene Names
FAM150A; UNQ9433
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ALK and LTK ligand 1 (ALKAL1); Recombinant Human ALK and LTK ligand 1 (ALKAL1); Protein FAM150A; ALKAL1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
28-129. Full Length of Mature Protein
Sequence
RPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
15.4
NCBI Official Full Name
protein FAM150A
NCBI Official Synonym Full Names
family with sequence similarity 150, member A
NCBI Official Symbol
FAM150A
NCBI Official Synonym Symbols
UNQ9433
NCBI Protein Information
protein FAM150A; RPLK9433
UniProt Protein Name
Protein FAM150A
UniProt Gene Name
FAM150A
UniProt Synonym Gene Names
UNQ9433/PRO34745
UniProt Entry Name
F150A_HUMAN
Uniprot Description
FAM150A: Belongs to the FAM150 family.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 8q11.23
Cellular Component: extracellular region
Similar Products
Product Notes
The ALKAL1 fam150a (Catalog #AAA1302617) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 28-129. Full Length of Mature Protein. The amino acid sequence is listed below: RPRGRRGARV TDKEPKPLLF LPAAGAGRTP SGSRSAEIFP RDSNLKDKFI KHFTGPVTFS PECSKHFHRL YYNTRECSTP AYYKRCARLL TRLAVSPLCS QT. It is sometimes possible for the material contained within the vial of "ALK and LTK ligand 1 (ALKAL1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
