Testing Data (TD)
Aculeacin-A acylase (aac) Recombinant Protein | aac recombinant protein
Recombinant Actinoplanes utahensis Aculeacin-A acylase (aac), partial
Reactivity
Actinoplanes utahensis
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Aculeacin-A acylase (aac); Recombinant Actinoplanes utahensis Aculeacin-A acylase (aac); partial; Aculeacin-A acylase small subunit; Aculeacin-A acylase large subunit; aac recombinant protein
Host
E Coli
Reactivity
Actinoplanes utahensis
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Tris-based buffer, 50% glycerol
Sequence Positions
Partial, 35-214aa
Sequence
GGYAALIRRASYGVPHITADDFGSLGFGVGYVQAEDNICVIAESVVTANGERSRWFGATGPDDADVRTTSSTQAIDDRVAERLLEGPRDGVRAPCDDVRDQMRGFVAGYNHFLRRTGVHRLTDPACRGKAWVRPLSEIDLWRTSWDSMVRAGSGALLDGIVAATPPTAAGPASAPEAPDA
Calculated MW
35.1 kDa
Tag Info
N-terminal 6xHis-SUMO-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80° C. The shelf life of lyophilized form is 12 months at -20 °C/-80°C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Generally, the shelf life of liquid form is 6 months at -20°C/-80° C. The shelf life of lyophilized form is 12 months at -20 °C/-80°C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Testing Data (TD)
Testing Data (TD)
Related Product Information for aac recombinant protein
Recombinant Protein
Catalyzes the hydrolysis of the palmitoyl moiety of the antifungal antibiotic, aculeacin-A, giving a hexapeptide moiety and a long chain fatty acid.
Catalyzes the hydrolysis of the palmitoyl moiety of the antifungal antibiotic, aculeacin-A, giving a hexapeptide moiety and a long chain fatty acid.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
NCBI Official Full Name
Aculeacin-A acylase
UniProt Protein Name
Aculeacin-A acylase
Protein Family
UniProt Gene Name
aac
Uniprot Description
Catalyzes the hydrolysis of the palmitoyl moiety of the antifungal antibiotic, aculeacin-A, giving a hexapeptide moiety and a long chain fatty acid.
Similar Products
Product Notes
The aac aac (Catalog #AAA9423388) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Partial, 35-214aa. The Recombinant Actinoplanes utahensis Aculeacin-An acylase (aac), partial reacts with Actinoplanes utahensis and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: GGYAALIRRA SYGVPHITAD DFGSLGFGVG YVQAEDNICV IAESVVTANG ERSRWFGATG PDDADVRTTS STQAIDDRVA ERLLEGPRDG VRAPCDDVRD QMRGFVAGYN HFLRRTGVHR LTDPACRGKA WVRPLSEIDL WRTSWDSMVR AGSGALLDGI VAATPPTAAG PASAPEAPDA. It is sometimes possible for the material contained within the vial of "Aculeacin-A acylase (aac), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
