RAC-alpha serine/threonine-protein kinase (akt1) Recombinant Protein | akt1 recombinant protein

Recombinant Xenopus laevis RAC-alpha serine/threonine-protein kinase (akt1)

Cat. Num. AAA1405674

• Gene Names: akt1.S; pkb; xAct; akt-1; v-akt; v-akt1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: RAC-alpha serine/threonine-protein kinase (akt1); Recombinant Xenopus laevis RAC-alpha serine/threonine-protein kinase (akt1); akt1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-481, Full length protein
• Sequence: MNEVAIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFSVAKCQLMKTERPKPNTFIIRCLQWTTVIERTFHVDSPEEREEWIQVIQHVADNLKKQEEEMMEVRSGDSPSDNSGAEEMEVSHSKPKHKVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERIFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLLPEAKSLLSGLLKKDPKQRLGGGPDDAKEIMQHKFFAGIVWQDVYEKKLVPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDNFEFVDNERRPHFPQFSYSASGNA
• Sequence Length: 481

• Species: Xenopus laevis (African clawed frog)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 147904038
• NCBI GeneID: 399170
• NCBI Accession #: NP_001083878.1
• NCBI GenBank Nucleotide #: NM_001090409.2
• UniProt Accession #: Q98TY9
• Molecular Weight: 56,042 Da
• NCBI Official Full Name: RAC-alpha serine/threonine-protein kinase
• NCBI Official Synonym Full Names: v-akt murine thymoma viral oncogene homolog 1 S homeolog
• NCBI Official Symbol: akt1.S
• NCBI Official Synonym Symbols: pkb; xAct; akt-1; v-akt; v-akt1
• NCBI Protein Information: RAC-alpha serine/threonine-protein kinase
• UniProt Protein Name: RAC-alpha serine/threonine-protein kinase
• Protein Family: RAC serine/threonine-protein kinase
• UniProt Gene Name: akt1
• UniProt Synonym Gene Names: xAkt; PKB alpha

Uniprot Description

AKT1 is one of several closely related serine/threonine-protein kinases known as the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis. This is mediated through serine and/or threonine phosphorylation of a range of downstream substrates. Over 100 substrate candidates have been reported so far, but for most of them, no isoform specificity has been reported. Signals downstream of phosphatidylinositol 3-kinase (PI3K) to mediate the effects of various growth factors such as platelet-derived growth factor (PDGF), epidermal growth factor (EGF), insulin and insulin-like growth factor I (IGF-I). Plays a role as a key modulator of the AKT-mTOR signaling pathway controlling the tempo of the process of newborn neurons integration during adult neurogenesis, including correct neuron positioning, dendritic development and synapse formation. Plays a role in glucose transport by mediating insulin-induced translocation of the GLUT4 glucose transporter to the cell surface. Mediates the antiapoptotic effects of IGF-I. Mediates insulin-stimulated protein synthesis, partly by playing a role in both insulin-induced phosphorylation of 4E-BP1 and in insulin-induced activation of p70 S6 kinase. Promotes glycogen synthesis by mediating the insulin-induced activation of glycogen synthase (). Required for insulin-stimulated meiotic reinitiation during oocyte maturation.